KEGG   Anolis carolinensis (green anole): 100562160Help
Entry
100562160         CDS       T01608                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:acs00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 371 aa AA seqDB search
MATPKSILNLLTFTFGSAIGFFICYLLFSLVFEEQIRIEPHIVYNDPHGHHSNSDERNNL
KGQMNFNADTGQHQDENKKVAEELYQKVRVLCWVMTGPQNLETKAKHVKATWAQHCNKVL
FMSSEENKDFPTVGLETKEGRDQLYWKTIKAFQYVHDHYLDEADWFMKADDDTYVALDNL
RWLLSKYSSERPIYFGRRFKPFVKQGYMSGGAGYVLSKEALKRFVDAFKNNKCTHSSSIE
DLALGKCMESINVEAGDSRDTSGKETFHPFVPEHHLIKGYLPRNFWYWNYNYYPPVEGPG
CCSDLAVSFHYVDATTMYHLEYLIYHLRPYGYQFRYNSDSPKDPGMQNLSEAAKEDVKSK
AEVGNPPKASG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggccactccaaaatccatattgaatcttctgacctttacttttggatctgcaattggg
tttttcatatgttatctgctatttagcttagtatttgaagaacaaatcaggattgagcct
cacattgtttacaatgatcctcatggacatcactcgaatagtgatgaaagaaataatctg
aaaggacaaatgaatttcaatgcagatactggacaacatcaagatgaaaacaagaaggtt
gctgaagaactgtaccagaaggtaagagtcctttgttgggtgatgactggtcctcagaat
ctggaaacaaaagctaaacatgtcaaagctacgtgggctcagcattgcaacaaggtgctg
tttatgagctctgaagaaaacaaagactttccaacagttggattagaaaccaaagaaggc
agagaccagctgtattggaaaaccattaaagctttccagtatgtgcatgatcattatctt
gatgaagcagactggtttatgaaagcagatgatgacacttatgttgctctggacaacctg
agatggctcctttcaaaatacagctctgaaagaccgatttattttggaagaagatttaag
ccatttgtgaaacagggctatatgagtggaggtgcaggctatgtgctgagcaaagaagct
ctgaagcgatttgtagatgcttttaaaaacaacaaatgtactcatagctcctccattgaa
gacttggcattaggcaaatgcatggaaagcattaatgtagaagctggagattccagggat
acgagtggcaaggaaacttttcacccatttgtgccagagcatcatttaatcaaaggatac
ctacccagaaatttttggtactggaattataactattaccctcctgtggagggtcctggc
tgctgttctgacttggcagtttcattccactatgttgatgccactactatgtatcatttg
gaatatttgatttatcatctccgtccttatggctaccagtttaggtacaactctgactct
cctaaagacccaggaatgcaaaatttaagtgaagcagcaaaggaggacgtgaaatccaaa
gcagaagtaggaaatcctcctaaagcctctggataa

DBGET integrated database retrieval system