KEGG   Anolis carolinensis (green anole): 100562207Help
Entry
100562207         CDS       T01608                                 

Gene name
flna
Definition
filamin A, alpha
Orthology
K04437  
filamin
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100562207 (flna)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100562207 (flna)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100562207 (flna)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100562207 (flna)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 2678 aa AA seqDB search
MTARQASGSAHPEANSVWQSGSDFSAVMTPTYHGSCAFKCGPILLSAGVPPTASPAVIMS
GSQARLHQASGAGGGGGGRGGGVGGGSSIIGPGEDAAEMPATEKDLAEDAPWKKIQQNTF
TRWCNEHLKCVQKRIANLQTDLGDGLRLIALLEVLSQKKMGRKYNARPTFRQMQLENVSV
ALEFLERENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPIWDEEDDEEAKKQTPK
QRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAM
QQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGP
GIEPTGNMVKKKAEFTVETISAGQGEVLVYVEDPAGHREEAKVIANNDKNRTFSVWYVPK
VTGVHKVTVLFAGQHIAKSPFEVNVDKSHGDASKVTAQGPGLEPSGNIANKTTYFEIFTA
GAGVGEIEVIIQDPTGKKGTVEQNLEDKGNSTYRCTYKPILEGTYTIYITFGGIPIPRSP
YTVTVGQACNPNACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGLEERV
KQKDLGDGVYSFEYYPTVPGNYTVTITWGGQHIPRSPFEVKVGTECTNQKVRAWGPGLEG
GVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEPGEYAVHVF
CNSEDIKLSPFMAEIKAAPKDFHPEKVKAYGPGLDKTGVAVNKPAEFTVDAKNGGKAPLK
VQVQDSDGSPVDVSMKDNGNGTYSCSYVPKKPVKHTAMVSWGGVNIPNSPYRVNVGAGSH
PNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPAEADINFNIIR
NDNDTFTVKYTPHGAGSYTIMVLFADQATPTSPIRIKVDPSHDASKVKAEGPGLNRNGVE
IGKPTYFTVNTKAAGKAKLDVQFTGPAKGEAVRDSEIIDHHDNTYTVKYTPVQQGNIGVN
VTYGGDHIPKSPFNVGVAPTLDLSKIKISGLGDKVEVGKDQEFTVKSKGAGGQGKVATKI
TGPSNKPVPCKVEPGLSSDNSVVKFIPREEGPYEVDVTYDGVPVPGSPFPVEAVPPTNPS
KVKAHGPGLKGGLAGSPAPFTIDTKGAGNGGLGLTVEGPCEAKIECLDNGDGTCSVSYLP
TEPGEYNINILFADTHVPGSPFKAQVVPGFDPSKVKCSGPGLEHATVGQAGEFSVDCSSA
GSAELTIEIISESGTQAEVHVRDNGDGTYTITYIPLCPGVYTITIKYGGQPIPNFPSKLN
VEPAMDTSGVKVYGPGVEGKGVFREATTEFNVDARTLTKTGGPHVKTRVSNPSGNVTESY
VRDNGDGTYNVEYTPYEDGVHSIDVTYDGSPVPSSPFRVPVTEGCDPTRVRVHGPGIQNG
TTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCTDNKDGSCSVEYIPYEPGTYSLNVTY
DGHQVPGSPFKVPVNDVVDSSKVKCSGPGLTPGVVRANVPQSFTIDTSKAGVAPLQVKVQ
GPKGVVEPVDVVDNADGTQTASYVPSREGPYNIAVIYGDEEVPRSPFKVKVLPTHDASKV
KASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKATIRDNQDGTYTVSY
VPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGIGPTIQIGE
ETVITVDAKAAGKGKVTCTVCTPDGTEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGG
EHIPNSPFQVTATDRPINGLDAGLRPFDLVIPFTIKKGEITGEVRMPSGKVAKPDITDNK
DGTVTVRYAPTEAGLHEMDIRYDNMHIPGSPLQFYVDYVNSGHVTAYGPGLIHGVVNKPA
VFTVNTKDAGEGGLSLAIEGPSKAEIGCTDNQDGTCTVSYLPVLPGDYNILVKYNDKHIP
GSPFTAKITADDTMRMSHLKVGSSADIPLNITETDLSQLTATVIPPSGREEPCLLKRLRN
GHVGISFVPKEIGEHIVNIKKNGLHIPSSPITVMISQSEIGDASRVRVSGPGLSEGRTFE
PSEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCKVTYCPTEPGNYIINIKFADQH
VPGSPFSVKVTGEGRMKQMITRRQKAPSVANIGTECDLSLKIPEINIRDMTAQVTSPSGK
SHDAEILEAENNTYCIRFVPTETGIHSVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAG
GPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYIVQEPGD
YEVSVKFNDEHIPDSPFVVPATSTSDDARRLTVSSLQESGLKVNQPASFAVSLNGAKGVI
DAKVHSPSGALEECHVTEIDEDKYAVRFIPRENGIYSVDVKFNGSHIPGSPFKIRVGEVG
QAGDPGMVSAYGPGLEGGITGKPAEFIVNTTNAGPGALAVTIDGPSKVKMDCQECPEGYK
VIYTPMVPGSYLISIKFGGPYHIAGSPFKAKITGTRLVPSHSLHETSSVFMDGAAKPDGA
TPKFASDASKVVAKGLGLNKGFVGQKNSFTVDCSKAGNNMLLVGVHGPKTPCEEIVVKHL
GNRLYNVTYLLKDRGDYVLVVKWGDEHIPGSPFHVSVP
NT seq 8037 nt NT seq  +upstreamnt  +downstreamnt
atgacggctcgccaggcaagtggatctgctcacccggaagcaaacagtgtttggcagagc
ggttcagacttcagtgctgtcatgacgcccacctaccatggctcctgcgcctttaagtgc
ggccccatcctactcagcgccggagtcccacccaccgccagccccgccgttataatgagc
ggctcccaggcgcgcctgcatcaggcctccggagcgggaggaggaggaggcgggagaggc
ggcggcgttggaggaggcagcagcatcatcggccccggggaggacgccgccgagatgccg
gccacggagaaggacctggcggaggacgcgccttggaagaagatccagcagaacaccttc
acgcgctggtgcaacgagcacctcaagtgcgtccagaagcgcatcgccaacctgcagaca
gacctgggcgacgggctgcggctgatcgcgctgctcgaggtgctgagccagaagaagatg
ggccgcaagtacaacgcccggcccaccttccgccagatgcagctggagaacgtctccgtc
gccctggagttcctcgagagggagaacatcaagctcgtctccatcgacagcaaagctatt
gtagatgggaacctgaagctgatcctgggcctgatctggacgctgatcctgcattattcc
atctccatgcccatttgggatgaagaggatgacgaagaggccaagaagcaaacccccaaa
caacggctgctgggctggatccaaaacaaattgcctcagttgcccatcacaaacttcagc
agagattggcagagtggccgggctttgggagctctcgttgacagctgcgctccaggtctg
tgtcctgactgggattcatgggatgccagcaagcctgtcaacaatgccagggaggccatg
cagcaagctgatgattggttgggcatcccacaggtgatcactcctgaagagattgtggat
cccaacgtcgatgagcactccgtcatgacatacctctcccagttccccaaagccaagcta
aagccaggagcccctcttagacccaagctgaaccctaagaaggccagggcttatgggcca
ggtatcgaacccacggggaacatggtgaaaaagaaggccgagttcactgtagaaacaata
agtgctggtcagggagaagtactggtatatgttgaggaccctgctgggcaccgtgaagaa
gctaaggtgattgcaaacaatgacaagaatcggaccttttctgtgtggtatgtgccaaag
gtgacaggtgttcacaaggtgacagtactgtttgccgggcagcatattgccaaaagtccc
tttgaggttaatgtggacaaatcacatggagatgccagcaaagtcactgcccagggccct
ggcttggagccttcaggaaacattgccaacaagaccacctactttgagattttcactgct
ggtgctggagttggggaaattgaagtcatcattcaagacccaacaggcaaaaaggggaca
gtcgagcaaaatttggaggacaagggcaacagtacctaccgctgcacctataaacccatc
ttggagggcacatataccatctacatcacctttggtgggatccctatcccccgcagtcca
tatacagtcactgtggggcaggcatgcaatcccaatgcctgcagagcagtgggccgaggc
ctacagcccaaaggtgtccgggtgaaggaaacggcagatttcaaggtctacacaaaaggt
gccggcagtggcgaactaaaagttacagtgaaaggcccaaaaggactagaggaacgtgtc
aagcagaaggacttgggtgatggtgtgtacagctttgagtactaccccactgtgcctggg
aactacacagtcacaattacttggggtggacagcacatcccccgcagcccatttgaggta
aaagtgggaacagaatgcacaaaccagaaggtgagagcctggggacccggtttggaagga
ggcgtcgttggcaagtcagctgattttgtggtggaggccatcggagatgatgttggcaca
ctaggtttctcagtggagggcccttcgcaggctaagattgaatgtgatgacaaaggtgac
ggctcttgtgacgtgcgctactggccccaggaacctggcgagtatgctgttcatgtgttc
tgcaacagtgaggacataaagctcagtcccttcatggctgagatcaaagctgctcccaag
gacttccaccctgagaaggtaaaagcctatggcccagggctagacaagactggtgttgct
gtcaacaaacctgcagaatttacagtggatgctaagaatggtggaaaggcacctctcaaa
gtgcaagtacaggattctgatggatctcccgtggatgtctccatgaaggacaatggcaat
ggtacctacagctgctcctatgtgcccaagaagcccgtgaagcacacagccatggtctcc
tggggaggagtcaacatccccaacagtccctacagggtgaatgttggagctggcagtcac
cccaacaaagtgaaagtatatggtcccggtgtggcgaaaactggcctgaaggctcacgaa
cctacttattttacagtcgactgcacagaggctggacaaggtgatgtgagcattgggatt
aagtgtgccccaggtgttgtgggtccagccgaggcagacatcaactttaacatcattcgg
aatgacaacgacacattcacagtcaagtatactccccatggtgctggcagctataccatc
atggtgctttttgctgaccaggccacccccaccagccccatcagaattaaagtggacccc
tcgcatgatgctagcaaggtgaaggctgagggacctggcctcaacaggaatggtgtagag
attggcaagccaacttatttcacagtcaataccaaggcagctggtaaggccaagctggat
gtccaattcactggcccagccaaaggagaggctgttagagattctgaaataattgatcac
catgataacacctatactgtcaagtacacccctgtgcaacagggtaacattggagtgaac
gtaacatatggaggagaccacatcccaaagagcccattcaacgtgggagtggcacccacc
ctggacctcagcaaaatcaagatctccggtcttggagacaaagtggaagtgggcaaagac
caggaattcaccgtcaagtccaagggggctggaggccaaggcaaagtggctactaagatc
acaggcccttcaaacaagcctgtaccctgcaaagtggaaccaggactcagctcggacaac
agcgtggtgaagttcatcccccgggaggaagggccctatgaggtggatgtgacctatgat
ggagtgcctgttccaggcagccccttccctgtggaagctgtgcctcccaccaacccatcc
aaggtgaaggcccatggtccaggcttgaagggtggcctggctggttctcctgcccccttt
accatagataccaaaggagctggaaatggtggccttggtctgactgtggagggcccttgc
gaggccaaaattgaatgcttggacaatggagatggcacgtgctcagtctcctatttgccc
actgaacctggagagtataacatcaacatccttttcgctgatacccatgtgcccggctct
cctttcaaagcccaggtggtgcctggctttgacccatcaaaggtgaaatgttctggccct
ggcctggaacatgccacagtgggacaggctggagagttcagcgtggattgctccagtgct
ggtagcgctgagctcaccattgagatcatttctgaaagtggcacacaagctgaagtccat
gtgcgggacaacggggatggcacatacaccatcacatacatccctctctgcccgggtgtc
tacaccatcacaatcaaatacggtgggcagcctattccaaactttcccagcaagctcaat
gtggagccagctatggacacctctggagttaaggtctatgggcccggtgtggaaggcaaa
ggagtttttcgtgaggccaccactgagtttaatgtggatgcgcggacgctgacgaagacc
ggaggccctcatgtcaaaacaagagtgtcaaatccctctggaaacgtgacagagagttat
gtgcgtgacaatggcgatgggacctacaatgtggagtacacaccctatgaagatggtgtc
cactctattgatgtaacctatgatggcagccctgtgcccagtagccctttccgtgtccca
gtaacagaagggtgtgatcctacaagggtcagagtccatggccctggcatccaaaatggg
actacaaacaagccaaataaattcactgtggagaccaggggggctggtactggtggactg
ggtctagctgttgaaggtccttctgaagccaagatgtcctgcactgacaacaaagatggc
agctgctctgtggaatacattccctatgagccaggcacctacagcctcaatgtcacttac
gatggccaccaagtaccagggagtcctttcaaagtgccggtgaatgatgtggtggattca
tcaaaggttaaatgttcaggtcctggcctgactccaggtgtggtccgagccaatgtcccc
cagtctttcactatcgataccagcaaggcaggtgtggcacccctccaggtcaaagtccag
ggtcccaaaggggtggttgagcccgtggatgtggtggataatgctgatggaactcagact
gcaagttatgtgccgagcagggagggcccatacaatattgctgtaatttatggagatgag
gaagtgccacgcagcccattcaaggtcaaggtcctacccacacatgatgccagcaaagtg
aaggcaagtggcccggggctgaacacgaccggtgtacctgccagtctgccagtggagttc
acaatcgatgccaaggatgctggagagggcttattggctgttcagatcacagatcctgaa
ggcaaacccaaaaaggccactattcgggacaaccaagatggcacctacactgtgtcttat
gtgcctgacatgacaggtcgctacaccatccttataaagtacggtggggatgaaattccc
tactcgccataccgtatccgtgcattgcccactggtgatgccagcaagtgtacagtcaca
gtgtcgattggaggtcatgggctaggagctggcattggccccaccatccagattggtgaa
gagacggtaatcaccgtggatgccaaggctgccgggaagggcaaggtgacatgcaccgtt
tgtactcctgacggcactgaggtggacgttgatgtggtggaaaatgaggacggcaccttt
gacatcttctacacggcaccccagccaggcaaatatgtcatctgtgtgcgctttggagga
gaacatatccccaacagtcctttccaggtcacggcgacagaccgtcccatcaatgggctg
gatgctggactgcggcctttcgacttggttatcccttttaccatcaagaaaggagagata
acaggtgaggtgcgcatgccatctggcaaggtagcaaagccagacatcactgacaacaag
gatggcacagtgacggtgcgctatgcacccacagaagctggcttacatgagatggatatc
cgctatgacaatatgcacatcccaggcagtccccttcaattctatgtcgactatgtcaac
agtggccatgtgactgcctatgggccaggtcttatccatggggtagtcaacaagcctgca
gtcttcactgtcaatacaaaagatgcaggagaaggtggcctctctctggccattgaaggc
ccctctaaggctgagatcggctgcactgataaccaggatggcacttgtaccgtgtcctat
cttccagtcctaccgggtgactacaacatcctggtgaaatacaatgacaaacacatccca
ggaagtcctttcactgccaagattactgcagatgacacgatgcgcatgtcccacctgaaa
gtgggctcttctgctgacatccccctgaacatcacagagacagacttgagccaactgact
gccacagtgatcccaccatctggccgcgaggagccctgtctgctcaaacgactgcgcaat
gggcatgtaggaatttcctttgtccccaaagagattggagaacacattgtgaacatcaag
aagaatgggctgcacatccccagtagcccaatcacagtgatgattagccaatcagaaatt
ggtgacgccagtcgtgttagggtctctggtccagggctgagtgaaggccggacttttgaa
ccatcagaattcatcattgatacaagagatgctggttatggtgggctgagtttatctatt
gaaggccctagtaaggttgacatcaacacagaggacttagaagatgggacttgcaaagtc
acctattgcccaactgagcctggcaactacataatcaacatcaaatttgcagaccaacat
gttccaggcagcccattttctgtgaaggtcactggagagggtcgaatgaagcagatgatc
acacggcgccagaaagccccttcagtcgccaacattggcactgagtgtgacctcagtttg
aaaatcccagagatcaatatcagagacatgacagctcaggtgactagcccatcaggaaaa
tcccatgatgcagagatcttggaggctgaaaacaacacttactgcatccgctttgtgccc
actgagacaggcatccactcagtcagcgtcaaatacaaagggcagcatgtacctggaagc
cccttccaattcactgttgggcctcttggtgagggcggtgcccacaaggtccgggcaggt
ggcccaggcttggaaagagctgaagctggagtgccagctgaatttagcatttggacacgg
gaggcaggggcaggaggtctctccattgctgtggaaggtcccagtaaggcagaaattgct
tttgaggaccgcaaagatggctcatgtggtgtttcctacattgtgcaagagcctggcgac
tatgaagtttcagtgaagttcaatgatgagcacatcccagacagtccctttgtggtgcca
gccacctccacctcagatgatgcccgccggcttactgtttctagtcttcaggagtcaggg
ttaaaagtgaaccagccagcctcgtttgccgtcagcttgaacggggccaaaggtgtgatt
gatgccaaagtgcacagcccttcaggggccctggaagagtgccatgttacagaaatcgat
gaagataagtatgccgtgcgtttcatcccccgtgagaatggcatctattctgtcgatgtc
aaattcaatggcagccacatccctggcagccccttcaagattcgtgttggggaggtgggc
caagctggtgaccccgggatggtgtctgcttatggccctggcttagaaggtggtataaca
ggaaaacctgcagaattcatagtcaacaccacaaatgcgggacctggggcgctagctgtc
acaattgatggcccctcgaaagtgaagatggattgccaagagtgcccagagggctataag
gtcatctatacacccatggtgcctggtagttacctcatctccattaagtttggtggccca
taccacattgctggcagccctttcaaagccaaaatcacagggacccgcctggtccccagt
catagcctccacgagacttcctcagtcttcatggatggggcagccaaacctgatggagca
acacccaagtttgcctctgatgccagcaaagtggtggccaagggtctgggccttaacaag
ggttttgtggggcaaaagaattccttcactgttgattgcagcaaagcagggaacaacatg
ctgctggtgggcgtccatggccctaagaccccctgtgaggagattgtggtgaagcacctg
ggcaaccggctctataacgtcacctacctgctgaaggacagaggggattatgtgctggtg
gtgaaatggggagatgagcacatccccggcagcccctttcacgtctctgtgccttaa

DBGET integrated database retrieval system