KEGG   Anolis carolinensis (green anole): 100562207Help
Entry
100562207         CDS       T01608                                 

Gene name
flna
Definition
(RefSeq) filamin A
  KO
K04437  
filamin
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100562207 (flna)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100562207 (flna)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100562207 (flna)
Cytoskeleton proteins [BR:acs04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100562207 (flna)
  Intermediate filaments
   Intermediate filament-binding proteins
    100562207 (flna)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100562207 (flna)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
2
AA seq 2656 aa AA seqDB search
MSGSQARLHQASGAGGGGGGRGGGVGGGSSIIGPGEDAAEMPATEKDLAEDAPWKKIQQN
TFTRWCNEHLKCVQKRIANLQTDLGDGLRLIALLEVLSQKKMGRKYNARPTFRQMQLENV
SVALEFLERENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPIWDEEDDEEAKKQT
PKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNARE
AMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAY
GPGIEPTGNMVKKKAEFTVETISAGQGEVLVYVEDPAGHREEAKVIANNDKNRTFSVWYV
PKVTGVHKVTVLFAGQHIAKSPFEVNVDKSHGDASKVTAQGPGLEPSGNIANKTTYFEIF
TAGAGVGEIEVIIQDPTGKKGTVEQNLEDKGNSTYRCTYKPILEGTYTIYITFGGIPIPR
SPYTVTVGQACNPNACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGLEE
RVKQKDLGDGVYSFEYYPTVPGNYTVTITWGGQHIPRSPFEVKVGTECTNQKVRAWGPGL
EGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEPGEYAVH
VFCNSEDIKLSPFMAEIKAAPKDFHPEKVKAYGPGLDKTGVAVNKPAEFTVDAKNGGKAP
LKVQVQDSDGSPVDVSMKDNGNGTYSCSYVPKKPVKHTAMVSWGGVNIPNSPYRVNVGAG
SHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPAEADINFNI
IRNDNDTFTVKYTPHGAGSYTIMVLFADQATPTSPIRIKVDPSHDASKVKAEGPGLNRNG
VEIGKPTYFTVNTKAAGKAKLDVQFTGPAKGEAVRDSEIIDHHDNTYTVKYTPVQQGNIG
VNVTYGGDHIPKSPFNVGVAPTLDLSKIKISGLGDKVEVGKDQEFTVKSKGAGGQGKVAT
KITGPSNKPVPCKVEPGLSSDNSVVKFIPREEGPYEVDVTYDGVPVPGSPFPVEAVPPTN
PSKVKAHGPGLKGGLAGSPAPFTIDTKGAGNGGLGLTVEGPCEAKIECLDNGDGTCSVSY
LPTEPGEYNINILFADTHVPGSPFKAQVVPGFDPSKVKCSGPGLEHATVGQAGEFSVDCS
SAGSAELTIEIISESGTQAEVHVRDNGDGTYTITYIPLCPGVYTITIKYGGQPIPNFPSK
LNVEPAMDTSGVKVYGPGVEGKGVFREATTEFNVDARTLTKTGGPHVKTRVSNPSGNVTE
SYVRDNGDGTYNVEYTPYEDGVHSIDVTYDGSPVPSSPFRVPVTEGCDPTRVRVHGPGIQ
NGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCTDNKDGSCSVEYIPYEPGTYSLNV
TYDGHQVPGSPFKVPVNDVVDSSKVKCSGPGLTPGVVRANVPQSFTIDTSKAGVAPLQVK
VQGPKGVVEPVDVVDNADGTQTASYVPSREGPYNIAVIYGDEEVPRSPFKVKVLPTHDAS
KVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKATIRDNQDGTYTV
SYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGIGPTIQI
GEETVITVDAKAAGKGKVTCTVCTPDGTEVDVDVVENEDGTFDIFYTAPQPGKYVICVRF
GGEHIPNSPFQVTALDGERPTPQQMAQPMRAPPYAYPSGAQQPWGPAVTATDRPINGLDA
GLRPFDLVIPFTIKKGEITGEVRMPSGKVAKPDITDNKDGTVTVRYAPTEAGLHEMDIRY
DNMHIPGSPLQFYVDYVNSGHVTAYGPGLIHGVVNKPAVFTVNTKDAGEGGLSLAIEGPS
KAEIGCTDNQDGTCTVSYLPVLPGDYNILVKYNDKHIPGSPFTAKITADDTMRMSHLKVG
SSADIPLNITETDLSQLTATVIPPSGREEPCLLKRLRNGHVGISFVPKEIGEHIVNIKKN
GLHIPSSPITVMISQSEIGDASRVRVSGPGLSEGRTFEPSEFIIDTRDAGYGGLSLSIEG
PSKVDINTEDLEDGTCKVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRMKQMITR
RQKAPSVANIGTECDLSLKIPEINIRDMTAQVTSPSGKSHDAEILEAENNTYCIRFVPTE
TGIHSVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREA
GAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYIVQEPGDYEVSVKFNDEHIPDSPFVVPAT
STSDDARRLTVSSLQESGLKVNQPASFAVSLNGAKGVIDAKVHSPSGALEECHVTEIDED
KYAVRFIPRENGIYSVDVKFNGSHIPGSPFKIRVGEVGQAGDPGMVSAYGPGLEGGITGK
PAEFIVNTTNAGPGALAVTIDGPSKVKMDCQECPEGYKVIYTPMVPGSYLISIKFGGPYH
IAGSPFKAKITGTRLVPSHSLHETSSVFMDGAAKPDGATPKFASDASKVVAKGLGLNKGF
VGQKNSFTVDCSKAGNNMLLVGVHGPKTPCEEIVVKHLGNRLYNVTYLLKDRGDYVLVVK
WGDEHIPGSPFHVSVP
NT seq 7971 nt NT seq  +upstreamnt  +downstreamnt
atgagcggctcccaggcgcgcctgcatcaggcctccggagcgggaggaggaggaggcggg
agaggcggcggcgttggaggaggcagcagcatcatcggccccggggaggacgccgccgag
atgccggccacggagaaggacctggcggaggacgcgccttggaagaagatccagcagaac
accttcacgcgctggtgcaacgagcacctcaagtgcgtccagaagcgcatcgccaacctg
cagacagacctgggcgacgggctgcggctgatcgcgctgctcgaggtgctgagccagaag
aagatgggccgcaagtacaacgcccggcccaccttccgccagatgcagctggagaacgtc
tccgtcgccctggagttcctcgagagggagaacatcaagctcgtctccatcgacagcaaa
gctattgtagatgggaacctgaagctgatcctgggcctgatctggacgctgatcctgcat
tattccatctccatgcccatttgggatgaagaggatgacgaagaggccaagaagcaaacc
cccaaacaacggctgctgggctggatccaaaacaaattgcctcagttgcccatcacaaac
ttcagcagagattggcagagtggccgggctttgggagctctcgttgacagctgcgctcca
ggtctgtgtcctgactgggattcatgggatgccagcaagcctgtcaacaatgccagggag
gccatgcagcaagctgatgattggttgggcatcccacaggtgatcactcctgaagagatt
gtggatcccaacgtcgatgagcactccgtcatgacatacctctcccagttccccaaagcc
aagctaaagccaggagcccctcttagacccaagctgaaccctaagaaggccagggcttat
gggccaggtatcgaacccacggggaacatggtgaaaaagaaggccgagttcactgtagaa
acaataagtgctggtcagggagaagtactggtatatgttgaggaccctgctgggcaccgt
gaagaagctaaggtgattgcaaacaatgacaagaatcggaccttttctgtgtggtatgtg
ccaaaggtgacaggtgttcacaaggtgacagtactgtttgccgggcagcatattgccaaa
agtccctttgaggttaatgtggacaaatcacatggagatgccagcaaagtcactgcccag
ggccctggcttggagccttcaggaaacattgccaacaagaccacctactttgagattttc
actgctggtgctggagttggggaaattgaagtcatcattcaagacccaacaggcaaaaag
gggacagtcgagcaaaatttggaggacaagggcaacagtacctaccgctgcacctataaa
cccatcttggagggcacatataccatctacatcacctttggtgggatccctatcccccgc
agtccatatacagtcactgtggggcaggcatgcaatcccaatgcctgcagagcagtgggc
cgaggcctacagcccaaaggtgtccgggtgaaggaaacggcagatttcaaggtctacaca
aaaggtgccggcagtggcgaactaaaagttacagtgaaaggcccaaaaggactagaggaa
cgtgtcaagcagaaggacttgggtgatggtgtgtacagctttgagtactaccccactgtg
cctgggaactacacagtcacaattacttggggtggacagcacatcccccgcagcccattt
gaggtaaaagtgggaacagaatgcacaaaccagaaggtgagagcctggggacccggtttg
gaaggaggcgtcgttggcaagtcagctgattttgtggtggaggccatcggagatgatgtt
ggcacactaggtttctcagtggagggcccttcgcaggctaagattgaatgtgatgacaaa
ggtgacggctcttgtgacgtgcgctactggccccaggaacctggcgagtatgctgttcat
gtgttctgcaacagtgaggacataaagctcagtcccttcatggctgagatcaaagctgct
cccaaggacttccaccctgagaaggtaaaagcctatggcccagggctagacaagactggt
gttgctgtcaacaaacctgcagaatttacagtggatgctaagaatggtggaaaggcacct
ctcaaagtgcaagtacaggattctgatggatctcccgtggatgtctccatgaaggacaat
ggcaatggtacctacagctgctcctatgtgcccaagaagcccgtgaagcacacagccatg
gtctcctggggaggagtcaacatccccaacagtccctacagggtgaatgttggagctggc
agtcaccccaacaaagtgaaagtatatggtcccggtgtggcgaaaactggcctgaaggct
cacgaacctacttattttacagtcgactgcacagaggctggacaaggtgatgtgagcatt
gggattaagtgtgccccaggtgttgtgggtccagccgaggcagacatcaactttaacatc
attcggaatgacaacgacacattcacagtcaagtatactccccatggtgctggcagctat
accatcatggtgctttttgctgaccaggccacccccaccagccccatcagaattaaagtg
gacccctcgcatgatgctagcaaggtgaaggctgagggacctggcctcaacaggaatggt
gtagagattggcaagccaacttatttcacagtcaataccaaggcagctggtaaggccaag
ctggatgtccaattcactggcccagccaaaggagaggctgttagagattctgaaataatt
gatcaccatgataacacctatactgtcaagtacacccctgtgcaacagggtaacattgga
gtgaacgtaacatatggaggagaccacatcccaaagagcccattcaacgtgggagtggca
cccaccctggacctcagcaaaatcaagatctccggtcttggagacaaagtggaagtgggc
aaagaccaggaattcaccgtcaagtccaagggggctggaggccaaggcaaagtggctact
aagatcacaggcccttcaaacaagcctgtaccctgcaaagtggaaccaggactcagctcg
gacaacagcgtggtgaagttcatcccccgggaggaagggccctatgaggtggatgtgacc
tatgatggagtgcctgttccaggcagccccttccctgtggaagctgtgcctcccaccaac
ccatccaaggtgaaggcccatggtccaggcttgaagggtggcctggctggttctcctgcc
ccctttaccatagataccaaaggagctggaaatggtggccttggtctgactgtggagggc
ccttgcgaggccaaaattgaatgcttggacaatggagatggcacgtgctcagtctcctat
ttgcccactgaacctggagagtataacatcaacatccttttcgctgatacccatgtgccc
ggctctcctttcaaagcccaggtggtgcctggctttgacccatcaaaggtgaaatgttct
ggccctggcctggaacatgccacagtgggacaggctggagagttcagcgtggattgctcc
agtgctggtagcgctgagctcaccattgagatcatttctgaaagtggcacacaagctgaa
gtccatgtgcgggacaacggggatggcacatacaccatcacatacatccctctctgcccg
ggtgtctacaccatcacaatcaaatacggtgggcagcctattccaaactttcccagcaag
ctcaatgtggagccagctatggacacctctggagttaaggtctatgggcccggtgtggaa
ggcaaaggagtttttcgtgaggccaccactgagtttaatgtggatgcgcggacgctgacg
aagaccggaggccctcatgtcaaaacaagagtgtcaaatccctctggaaacgtgacagag
agttatgtgcgtgacaatggcgatgggacctacaatgtggagtacacaccctatgaagat
ggtgtccactctattgatgtaacctatgatggcagccctgtgcccagtagccctttccgt
gtcccagtaacagaagggtgtgatcctacaagggtcagagtccatggccctggcatccaa
aatgggactacaaacaagccaaataaattcactgtggagaccaggggggctggtactggt
ggactgggtctagctgttgaaggtccttctgaagccaagatgtcctgcactgacaacaaa
gatggcagctgctctgtggaatacattccctatgagccaggcacctacagcctcaatgtc
acttacgatggccaccaagtaccagggagtcctttcaaagtgccggtgaatgatgtggtg
gattcatcaaaggttaaatgttcaggtcctggcctgactccaggtgtggtccgagccaat
gtcccccagtctttcactatcgataccagcaaggcaggtgtggcacccctccaggtcaaa
gtccagggtcccaaaggggtggttgagcccgtggatgtggtggataatgctgatggaact
cagactgcaagttatgtgccgagcagggagggcccatacaatattgctgtaatttatgga
gatgaggaagtgccacgcagcccattcaaggtcaaggtcctacccacacatgatgccagc
aaagtgaaggcaagtggcccggggctgaacacgaccggtgtacctgccagtctgccagtg
gagttcacaatcgatgccaaggatgctggagagggcttattggctgttcagatcacagat
cctgaaggcaaacccaaaaaggccactattcgggacaaccaagatggcacctacactgtg
tcttatgtgcctgacatgacaggtcgctacaccatccttataaagtacggtggggatgaa
attccctactcgccataccgtatccgtgcattgcccactggtgatgccagcaagtgtaca
gtcacagtgtcgattggaggtcatgggctaggagctggcattggccccaccatccagatt
ggtgaagagacggtaatcaccgtggatgccaaggctgccgggaagggcaaggtgacatgc
accgtttgtactcctgacggcactgaggtggacgttgatgtggtggaaaatgaggacggc
acctttgacatcttctacacggcaccccagccaggcaaatatgtcatctgtgtgcgcttt
ggaggagaacatatccccaacagtcctttccaggtcacggccctggatggtgagcgcccg
accccccaacagatggctcagccgatgcgtgccccaccctacgcatatccgtctggtgca
cagcagccctggggaccagcagtaacagcgacagaccgtcccatcaatgggctggatgct
ggactgcggcctttcgacttggttatcccttttaccatcaagaaaggagagataacaggt
gaggtgcgcatgccatctggcaaggtagcaaagccagacatcactgacaacaaggatggc
acagtgacggtgcgctatgcacccacagaagctggcttacatgagatggatatccgctat
gacaatatgcacatcccaggcagtccccttcaattctatgtcgactatgtcaacagtggc
catgtgactgcctatgggccaggtcttatccatggggtagtcaacaagcctgcagtcttc
actgtcaatacaaaagatgcaggagaaggtggcctctctctggccattgaaggcccctct
aaggctgagatcggctgcactgataaccaggatggcacttgtaccgtgtcctatcttcca
gtcctaccgggtgactacaacatcctggtgaaatacaatgacaaacacatcccaggaagt
cctttcactgccaagattactgcagatgacacgatgcgcatgtcccacctgaaagtgggc
tcttctgctgacatccccctgaacatcacagagacagacttgagccaactgactgccaca
gtgatcccaccatctggccgcgaggagccctgtctgctcaaacgactgcgcaatgggcat
gtaggaatttcctttgtccccaaagagattggagaacacattgtgaacatcaagaagaat
gggctgcacatccccagtagcccaatcacagtgatgattagccaatcagaaattggtgac
gccagtcgtgttagggtctctggtccagggctgagtgaaggccggacttttgaaccatca
gaattcatcattgatacaagagatgctggttatggtgggctgagtttatctattgaaggc
cctagtaaggttgacatcaacacagaggacttagaagatgggacttgcaaagtcacctat
tgcccaactgagcctggcaactacataatcaacatcaaatttgcagaccaacatgttcca
ggcagcccattttctgtgaaggtcactggagagggtcgaatgaagcagatgatcacacgg
cgccagaaagccccttcagtcgccaacattggcactgagtgtgacctcagtttgaaaatc
ccagagatcaatatcagagacatgacagctcaggtgactagcccatcaggaaaatcccat
gatgcagagatcttggaggctgaaaacaacacttactgcatccgctttgtgcccactgag
acaggcatccactcagtcagcgtcaaatacaaagggcagcatgtacctggaagccccttc
caattcactgttgggcctcttggtgagggcggtgcccacaaggtccgggcaggtggccca
ggcttggaaagagctgaagctggagtgccagctgaatttagcatttggacacgggaggca
ggggcaggaggtctctccattgctgtggaaggtcccagtaaggcagaaattgcttttgag
gaccgcaaagatggctcatgtggtgtttcctacattgtgcaagagcctggcgactatgaa
gtttcagtgaagttcaatgatgagcacatcccagacagtccctttgtggtgccagccacc
tccacctcagatgatgcccgccggcttactgtttctagtcttcaggagtcagggttaaaa
gtgaaccagccagcctcgtttgccgtcagcttgaacggggccaaaggtgtgattgatgcc
aaagtgcacagcccttcaggggccctggaagagtgccatgttacagaaatcgatgaagat
aagtatgccgtgcgtttcatcccccgtgagaatggcatctattctgtcgatgtcaaattc
aatggcagccacatccctggcagccccttcaagattcgtgttggggaggtgggccaagct
ggtgaccccgggatggtgtctgcttatggccctggcttagaaggtggtataacaggaaaa
cctgcagaattcatagtcaacaccacaaatgcgggacctggggcgctagctgtcacaatt
gatggcccctcgaaagtgaagatggattgccaagagtgcccagagggctataaggtcatc
tatacacccatggtgcctggtagttacctcatctccattaagtttggtggcccataccac
attgctggcagccctttcaaagccaaaatcacagggacccgcctggtccccagtcatagc
ctccacgagacttcctcagtcttcatggatggggcagccaaacctgatggagcaacaccc
aagtttgcctctgatgccagcaaagtggtggccaagggtctgggccttaacaagggtttt
gtggggcaaaagaattccttcactgttgattgcagcaaagcagggaacaacatgctgctg
gtgggcgtccatggccctaagaccccctgtgaggagattgtggtgaagcacctgggcaac
cggctctataacgtcacctacctgctgaaggacagaggggattatgtgctggtggtgaaa
tggggagatgagcacatccccggcagcccctttcacgtctctgtgccttaa

DBGET integrated database retrieval system