KEGG   Anolis carolinensis (green anole): 100562301Help
Entry
100562301         CDS       T01608                                 

Definition
clathrin heavy chain 1-like
Orthology
K04646  
clathrin heavy chain
Organism
acs  Anolis carolinensis (green anole)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100562301
   04142 Lysosome
    100562301
Exosome [BR:acs04147]
 Exosomal proteins
  Proteins found in most exosomes
   100562301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1672 aa AA seqDB search
MAQILPIRFQEHFQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMSDPTT
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMAEEVIFWKWISVNTVA
LVTETAVYHWSMEGDSLPQKMFDRHASLAGCQIINYRTDENQKWLLLIGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKIEGNGKPSTLFCFAVRSPAGGKLHIIEVGQPASGN
QPFVKKAVDVFFPPEAQTDFPVAMQIGTKHGVIYLITKYGYIHMYDLESGVCIYMNRISA
DTIFVTAPHEPTSGIIGVNKKGQVLSVCVEEDNIVNYATNVLQNPDLGLRMAIRSNLAGA
EELFARKFNTLFAQGNYAEAAKVAASAPKGILRTSDTIRKFQSVPAQPGQASPLLQYFGI
LLDQGQLNKFESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSADPTLALSVYL
RANVPNKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRSVMRVSPDQGLQFAQMLVQDE
EPLANINQIVDVFMENSLIQQCTSFLLDALKNNRPAEGHLQTRLLEMNLIHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSVECLRAMLSANIRQNLQLCVQVASKYHEQLGTQSLVELFESFKSYEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRIPAVVGGLLDVDCSEDVIKNLIMVVRGQF
STDELVAEVEKRNRLKLLLPWLESRIHEGCEEPATHNALAKIYIDSNNNPERFLRENPFY
DSRVVGKYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVRRKDPELWVSVL
EENNPFRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELYEEAFAIFRKFDVNTS
AIQVLIEHIGNLDRAYEFAERCNEPAVWSQLARAQLQKDLVKEAIDSYIKADDPSAYMEV
VQAANKNDNWEDLVKFLQMARKKARESYVETELIFALAKTNRLSELEEFVSGPNNAHIQQ
VGDRCYEEGMYDAAKLLYNNVSNFARLASTLVHLGEYQAAVDSARKANSTRTWKEVCFAC
VDGKEFRLAQICGLHIVIHADELEELISYYQDRGYFEELIALLEAALGLERAHMGMFTEL
AILYSKYKPQKMREHLELFWSRVNIPKVLRAAEQAHLWGELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIIAKVANVELYYKALQYYLDYKPLLINDLLLVLSPRLDHTRTVSFFT
KVNQLPLVKPYLRSVQNHNNKGVNEALNNLLTEEEDYQGLRASIDAYDNFDNITLAQRLE
KHELIEFRRIAAYLYKGNNRWKQSVELCKKDRLYKDAMQYAAESKDAELAEKLLQWFLEE
DKKECFAASLFTCYDLLHPDVVLELAWRHNIMDFAMPYFIQVMREYLTKVDKLDASESLR
KEEQEVTEPTPIVFGQQLMLTAGPTAVPPQANFSYGYPAPGFTHPPVYGFNM
NT seq 5019 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatactccccattcggtttcaggagcactttcagctccaaaatcttggaatt
aatccagcaaacattggattcagtaccttaacgatggagtctgacaaattcatatgtatc
agagagaaagtgggtgagcaagcacaagttgtgatcatagacatgagcgacccgacaact
cctatcagacgcccaatctctgccgaaagtgccatcatgaaccctgcttcgaaagtgatt
gctctcaaagcggggaaaaccctccagatttttaacattgagatgaaaagtaaaatgaaa
gcacacacaatggccgaggaggtgatcttttggaaatggatatctgtgaacacagtggcc
ttagtgacggagacggctgtgtatcactggagcatggaaggggactctctgccccaaaag
atgttcgacaggcacgccagtctcgcaggttgccaaatcatcaattacagaacggatgag
aatcaaaagtggctgctcctcataggaatctctgcccagcaaaaccgtgtggttggcgct
atgcagctgtattcggtggatcgaaaagtctcacagcctatcgaaggacacgcagcagcc
tttgcggagttcaagatagaaggaaatggcaagccttccacccttttctgttttgcagtg
cgtagccccgcaggtggcaagttgcatatcatcgaagtgggccagcctgcctctggaaac
cagccttttgtcaagaaagcagttgatgtgttctttccgcctgaggctcaaactgatttc
cctgtagcaatgcagattggaacaaaacatggtgttatctatctgatcacaaagtatgga
tacattcacatgtatgatttggaatctggtgtctgcatctacatgaaccgtattagtgcg
gacaccatctttgtcacggctcctcatgaacctacctctggtataattggagtgaacaaa
aaggggcaggtactctctgtttgtgtggaagaagataacattgtcaattacgccaccaat
gtgctccagaatccggacttgggactgcgtatggcaatccggagtaacttggctggagcg
gaggaactcttcgccaggaagtttaatactctttttgcacaaggaaactacgcagaagca
gccaaagttgccgcatctgcaccaaagggaatcctacgaaccagtgataccattcggaag
ttccagagcgtgcctgcacaaccggggcaggcctcgcccttgctgcagtattttggcatc
ctcctcgatcaaggccagctcaacaagtttgagtcgctcgaactctgccgtcccgtcctt
caacaaggccgcaaacagctgctagaaaaatggctgaaagaagataagctggaatgctct
gaggaactgggagacctagtcaagtctgcggacccaactcttgccctcagcgtttatctc
cgtgcaaatgtcccgaacaaagtaatccagtgttttgcagaaactggtcagttccagaaa
attgtcctttatgccaaaaaggttggctatacgccagattggattttcctattgagaagt
gtcatgagagtcagcccagatcagggcctccagtttgcccagatgttggtacaagatgag
gaacccctggccaatatcaaccagattgttgatgtcttcatggagaatagtttaattcag
cagtgtacttccttcttgttggatgccttgaaaaataatcgacctgcagaagggcacctt
cagacccgtctccttgagatgaacctcattcatgctccgcaggttgcagatgccatctta
ggaaatcagatgttcacccactacgaccgggctcacattgcccagctttgtgaaaaagca
ggcctgttacagcgtgcgttggagcactacactgacctttatgacatcaagcgggctgtt
gttcatactcatcttttgaacccagagtggcttgtgaacttctttggctctctgtccgtg
gaagactccgtagagtgcctgcgcgccatgctgtctgccaacatccggcaaaatctgcag
ctctgtgtgcaagttgcttcgaagtaccatgaacagttgggcacgcagtctcttgtggag
ctttttgaatcctttaaaagttatgaaggtctgttttatttcttgggctctattgtgaac
ttcagccaggacccagatgtccacttcaaatatatccaggctgcttgcaagacaggccaa
atcaaggaagttgaaaggatctgccgagaaagcaactgctacaatccagaacgggtgaaa
aacttcttgaaggaagccaagcttactgaccagcttcctctcatcattgtttgtgacaga
tttgactttgttcacgacctggttctctacttgtatcgaaacaacctacagaaatacatt
gagatctatgttcaaaaggtcaacccaagccgtatcccagccgtggttggagggctcctt
gatgtggattgctccgaagatgtcattaagaacttgatcatggtggtgagaggccagttc
tccaccgatgaattggttgctgaagtcgaaaaaaggaataggctgaagctgcttctgccg
tggctcgagtcccggatccatgaaggctgcgaagaaccggcaacccacaatgccctggcg
aagatctatatcgacagcaataacaacccggagcgcttcttgcgggagaaccccttctac
gacagccgggttgtagggaaatactgcgaaaaaagggacccgcacttggcctgtgtggct
tacgaaaggggccaatgtgaccttgagctgatcaaggtctgcaacgagaactccttgttc
aagagtgaagcacggtatctggttcgcagaaaagatccagaactgtgggtcagtgttctg
gaggaaaacaatccattcagaagaccactcattgatcaggttgtccagacggcattatcg
gagactcaggatccagaggaggtttcggtgacagtcaaggccttcatgacagccgacctg
cccaatgaactcattgagttgcttgaaaagattgttctggataattcagtcttcagtgaa
cataggaacctccagaatctactgattttgactgccatcaaagcagaccgcacacgtgtg
atggaatacatcaaccgcctggataactacgatgccccagatattgccaacattgctata
agcaatgaactctatgaagaagcgtttgccatctttaggaagtttgatgtgaatacctct
gcaattcaggtcttgattgagcatatcggcaacctggaccgtgcctatgagtttgcagag
agatgtaatgaacctgcggtttggagccagctggcgagggcccagctccaaaaggacctg
gtgaaggaagccattgactcttacatcaaggccgacgatccttctgcttatatggaggtt
gtgcaggccgccaacaagaacgataactgggaggacctggttaagttcttgcagatggct
aggaaaaaggccagagagtcttacgtcgagaccgaactcatttttgccttggccaaaacg
aatcggctctcagagttagaggaatttgtcagtggcccaaacaacgctcacatacaacag
gtgggagatcgctgctacgaggaggggatgtatgatgcagccaagctgttgtacaacaac
gtctctaactttgcccgcctggcatctacgctagttcatctgggagagtaccaggctgca
gtggatagtgcccgcaaagccaacagcaccaggacatggaaagaggtctgctttgcctgc
gtggatggaaaggagttccggcttgcgcagatctgtggcttacacatagtgatccatgcc
gacgagcttgaagaactgatcagttattatcaggaccgtggatacttcgaagagctgatt
gccctcttagaagcagccctgggcctggagcgggctcatatgggcatgttcaccgagctg
gccatcttgtattcgaaatacaaacctcagaagatgagggagcacctggaactgttctgg
tcccgagtcaatatcccaaaggtgcttcgagctgcagagcaagctcatctatggggagag
ctggtgttcctctatgacaaatatgaagagtacgataacgccatcattacgatgatgaac
catcccactgatgcttggaaagaagggcagtttaaggacatcattgccaaggtagccaac
gtggagctgtattacaaagccctgcagtactacttggattataagcctttgttgatcaac
gaccttctcttggtgttgtctccgcggctggatcacaccaggacggtcagttttttcacc
aaggtgaatcagctgcctctcgtgaaaccttacttgcgctcagtccagaaccataataat
aaaggagtcaatgaggctctaaacaaccttttgacggaagaggaggactaccagggcttg
cgagcatctattgatgcctacgacaattttgacaacattacactcgctcagcgcttggag
aaacatgagttgatcgaattcagacgtattgctgcttacctgtacaaaggcaacaacaga
tggaaacagagtgtggagctctgcaagaaagatcgtctttataaggatgccatgcaatat
gcagcggaatccaaggatgctgagctggcggagaagctgctccagtggttcctggaagaa
gacaagaaggagtgtttcgcagcctctctgtttacatgctacgacttattgcatcccgac
gtggtccttgagcttgcctggagacacaacattatggactttgcaatgccttatttcatc
caggtgatgagggaataccttaccaaagtggataaacttgatgcttctgaaagcctaagg
aaagaagaacaagaggtcacggaacccactccaatagtattcggccagcagctgatgctc
acggcaggccccaccgcagtacctccgcaagccaacttctcctatgggtacccggcgcca
ggattcacccacccgccagtttacggtttcaatatgtag

DBGET integrated database retrieval system