KEGG   Anolis carolinensis (green anole): 100562379Help
Entry
100562379         CDS       T01608                                 

Gene name
itgb6
Definition
(RefSeq) integrin subunit beta 6
  KO
K06589  integrin beta 6
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04510  Focal adhesion
acs04512  ECM-receptor interaction
acs04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100562379 (itgb6)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100562379 (itgb6)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100562379 (itgb6)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100562379 (itgb6)
Cell adhesion molecules [BR:acs04515]
 Integrins
  Integrin beta subunits
   100562379 (itgb6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2
Motif
Other DBs
NCBI-GeneID: 100562379
NCBI-ProteinID: XP_008117348
Ensembl: ENSACAG00000012153
UniProt: H9GIR3
Position
Un
AA seq 788 aa AA seqDB search
MGIELFYLLFLFLQRNENVQGNCDPGSAGNCEDCLLSGPHCGWCFQENFTDLSNIYKRCD
TPDKLIAKGCPSNLIEFPVSKVVIEKNKFLSEGPQKNNSDVTQISPQKLTVFLRPGNEET
IQINVRQTEDYPVDLYYLMDLSASMNDDLKNIKVLGSTLSKEMSKLTSNFQLGFGSFVEK
PVSPFINTLAEDIQNPCRGISHDCSPTFGYKHVLPLTNDAERFNDIVKKQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVTDADSHFGMDSKLAGIVIPNDGECHLDDNNE
YSMSTVLEYPSLGQLIDKIIQNNVLLIFAVTKGQVHLYQNYADLIPGATVGQLQEDSSNV
LQLIIDAYKALRSEIELEVLGDTEGINMSFTAICNNNTAIANGKKCSHIKVGEVVTFNLT
LSLSACEKSRRKVLIKPVGLSETLEIAIQPECSCTCQKEAEANSSKCNDGNGLFECGVCT
CNPGYLGPYCKCDEKESLGPDSCRSSPEQKYCSGRGDCYCGQCVCHLSAYGNIYGPDCEC
DDFSCVRLRGLLCGGNGDCDCNKCICHNGWMGEYCNCTTAIDNCISEDGTICSERGKCIC
GQCVCTHPGVSGSSCEKYAAYSDPCISKRNCVECYLMSDDRSQEDCTEICKLVDATVSTE
EETSEDKYVPCLLRGENECVITFLMTTDEHGKTTIHSIKQKDCPQHPNTTMIILGVSIAV
VVTGVVLLCIWKLFISFHDRKEVAKFEAERLKAKWQTGTNPLYRGSTTTFKNVTYKQKER
QPGSAADI
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggggattgaattgttttacctccttttcctatttcttcaaagaaatgagaatgtacaa
ggaaactgtgatccagggagtgcggggaactgtgaagactgtttgctttccggaccacac
tgcggctggtgttttcaagagaatttcactgacctgtctaacatttataaaagatgcgac
actcctgacaagctgattgcaaaaggatgcccatcaaatttgattgaattccctgtttct
aaagtagtaatcgaaaaaaataagttcctgagtgaaggtccacaaaaaaacaactcagac
gttacacagatttctcctcaaaagctaaccgtttttctgagaccaggaaatgaagaaaca
atacagatcaatgtgcgtcagactgaagattatccggtcgacctctactatctcatggat
ctttcggcttctatgaacgatgacctgaaaaacataaaggtactgggttctaccctatca
aaagaaatgtctaaactaacaagcaacttccagctgggttttgggtcattcgtagaaaaa
ccagtttcaccattcatcaatactctagcagaagacatacagaatccttgccgaggtatc
tcacatgactgctcgccaacatttggatacaagcatgttctgccactgacaaatgatgcc
gagaggtttaatgatattgtgaaaaaacagaaaatcagtgctaatatagacactccagag
ggaggatttgatgcaattatgcaggcagctgtgtgtaaggaaaaaattgggtggaggaat
gattcattacatctattggtgtttgtgactgatgcagattcccattttgggatggatagc
aaactagcaggaattgttattccgaatgatggagaatgccacttggatgacaataatgaa
tattccatgtcaactgttttggaatatccaagcttgggacaattaatagacaagataata
caaaacaatgttttattaatttttgcagtaacaaagggacaggttcatttatatcagaac
tatgctgatcttattcctggagctactgttggacaactacaagaagattctagcaatgtt
ctccagttgattattgatgcatacaaggcacttcggtctgaaattgaactagaagtatta
ggtgacacagagggaataaacatgtctttcactgctatctgtaacaacaacactgccatt
gcaaatgggaagaaatgctctcatattaaagtaggagaagtggttacttttaacttgaca
ttaagcctatctgcttgtgagaaaagtcgaaggaaagtcctaataaagcctgtgggtctc
agtgaaactttggaaattgctattcagccagagtgcagctgtacttgtcagaaagaagcc
gaggcaaacagctcaaagtgcaacgacggaaacggtttgttcgagtgtggagtttgcact
tgcaatcctggctacctgggcccttattgtaaatgtgatgaaaaagaatccctgggtcca
gattcctgcagaagttctcctgagcagaagtattgcagtggaagaggcgactgctactgc
gggcagtgcgtttgccacttgtcggcctatggcaatatttatgggccagactgtgaatgt
gacgatttctcttgtgtgagacttagaggactgctgtgtggaggtaatggagactgtgac
tgcaacaagtgtatctgccacaatgggtggatgggggagtactgtaactgcaccacagcc
attgacaactgcatttctgaagatgggacaatctgcagtgagagaggcaaatgcatttgt
ggtcaatgtgtttgcacacatcctggggtttcaggaagctcgtgtgagaaatatgctgcc
tacagcgatccttgcatttccaaaaggaactgcgtggaatgttatttaatgtctgatgat
cggtcacaggaagactgcacagaaatatgtaaactggttgatgccactgtcagtactgaa
gaagaaacttcagaggataaatatgttccttgtttattgcggggtgaaaatgagtgtgtt
attacatttctaatgacaactgatgaacatgggaaaacaactatccacagcataaaacag
aaagactgtccccaacatcccaatactacaatgattatactgggtgtctcaattgcagta
gttgtcactggtgttgttctgctttgcatatggaaattgtttatttcatttcatgaccgc
aaagaggttgctaaatttgaagcagagaggttaaaggccaaatggcaaacgggaaccaac
ccactctacagaggatcaacaacaacatttaaaaatgtaacatacaaacaaaaagaaaga
caaccaggatctgctgcagatatttaa

DBGET integrated database retrieval system