KEGG   Anolis carolinensis (green anole): 100562379Help
Entry
100562379         CDS       T01608                                 

Definition
integrin beta-6-like
Orthology
K06589  
integrin beta 6
Organism
acs  Anolis carolinensis (green anole)
Pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:acs04512]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:acs04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:acs04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 751 aa AA seqDB search
MNAEYASADGNFTDLSNIYKRCDTPDKLIAKGCPSNLIEFPVSKVVIEKNKFLSEGPQKN
NSDVTQISPQKLTVFLRPGNEETIQINVRQTEDYPVDLYYLMDLSASMNDDLKNIKVLGS
TLSKEMSKLTSNFQLGFGSFVEKPVSPFINTLAEDIQNPCRGISHDCSPTFGYKHVLPLT
NDAERFNDIVKKQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVTDADSHFG
MDSKLAGIVIPNDGECHLDDNNEYSMSTVLEYPSLGQLIDKIIQNNVLLIFAVTKGQVHL
YQNYADLIPGATVGQLQEDSSNVLQLIIDAYKALRSEIELEVLGDTEGINMSFTAICNNN
TAIANGKKCSHIKVGEVVTFNLTLSLSACEKSRRKVLIKPVGLSETLEIAIQPECSCTCQ
KEAEANSSKCNDGNGLFECGVCTCNPGYLGPYCKCDEKESLGPDSCRSSPEQKYCSGRGD
CYCGQCVCHLSAYGNIYGPDCECDDFSCVRLRGLLCGGNGDCDCNKCICHNGWMGEYCNC
TTAIDNCISEDGTICSERGKCICGQCVCTHPGVSGSSCEKYAAYSDPCISKRNCVECYLM
SDDRSQEDCTEICKLVDATVSTEEETSEDKYVPCLLRGENECVITFLMTTDEHGKTTIHS
IKQKDCPQHPNTTMIILGVSIAVVVTGVVLLCIWKLFISFHDRKEVAKFEAERLKAKWQT
GTNPLYRGSTTTFKNVTYKQKERQPGSAADI
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgaatatgcctctgcagatggtaatttcactgacctgtctaacatttataaa
agatgcgacactcctgacaagctgattgcaaaaggatgcccatcaaatttgattgaattc
cctgtttctaaagtagtaatcgaaaaaaataagttcctgagtgaaggtccacaaaaaaac
aactcagacgttacacagatttctcctcaaaagctaaccgtttttctgagaccaggaaat
gaagaaacaatacagatcaatgtgcgtcagactgaagattatccggtcgacctctactat
ctcatggatctttcggcttctatgaacgatgacctgaaaaacataaaggtactgggttct
accctatcaaaagaaatgtctaaactaacaagcaacttccagctgggttttgggtcattc
gtagaaaaaccagtttcaccattcatcaatactctagcagaagacatacagaatccttgc
cgaggtatctcacatgactgctcgccaacatttggatacaagcatgttctgccactgaca
aatgatgccgagaggtttaatgatattgtgaaaaaacagaaaatcagtgctaatatagac
actccagagggaggatttgatgcaattatgcaggcagctgtgtgtaaggaaaaaattggg
tggaggaatgattcattacatctattggtgtttgtgactgatgcagattcccattttggg
atggatagcaaactagcaggaattgttattccgaatgatggagaatgccacttggatgac
aataatgaatattccatgtcaactgttttggaatatccaagcttgggacaattaatagac
aagataatacaaaacaatgttttattaatttttgcagtaacaaagggacaggttcattta
tatcagaactatgctgatcttattcctggagctactgttggacaactacaagaagattct
agcaatgttctccagttgattattgatgcatacaaggcacttcggtctgaaattgaacta
gaagtattaggtgacacagagggaataaacatgtctttcactgctatctgtaacaacaac
actgccattgcaaatgggaagaaatgctctcatattaaagtaggagaagtggttactttt
aacttgacattaagcctatctgcttgtgagaaaagtcgaaggaaagtcctaataaagcct
gtgggtctcagtgaaactttggaaattgctattcagccagagtgcagctgtacttgtcag
aaagaagccgaggcaaacagctcaaagtgcaacgacggaaacggtttgttcgagtgtgga
gtttgcacttgcaatcctggctacctgggcccttattgtaaatgtgatgaaaaagaatcc
ctgggtccagattcctgcagaagttctcctgagcagaagtattgcagtggaagaggcgac
tgctactgcgggcagtgcgtttgccacttgtcggcctatggcaatatttatgggccagac
tgtgaatgtgacgatttctcttgtgtgagacttagaggactgctgtgtggaggtaatgga
gactgtgactgcaacaagtgtatctgccacaatgggtggatgggggagtactgtaactgc
accacagccattgacaactgcatttctgaagatgggacaatctgcagtgagagaggcaaa
tgcatttgtggtcaatgtgtttgcacacatcctggggtttcaggaagctcgtgtgagaaa
tatgctgcctacagcgatccttgcatttccaaaaggaactgcgtggaatgttatttaatg
tctgatgatcggtcacaggaagactgcacagaaatatgtaaactggttgatgccactgtc
agtactgaagaagaaacttcagaggataaatatgttccttgtttattgcggggtgaaaat
gagtgtgttattacatttctaatgacaactgatgaacatgggaaaacaactatccacagc
ataaaacagaaagactgtccccaacatcccaatactacaatgattatactgggtgtctca
attgcagtagttgtcactggtgttgttctgctttgcatatggaaattgtttatttcattt
catgaccgcaaagaggttgctaaatttgaagcagagaggttaaaggccaaatggcaaacg
ggaaccaacccactctacagaggatcaacaacaacatttaaaaatgtaacatacaaacaa
aaagaaagacaaccaggatctgctgcagatatttaa

DBGET integrated database retrieval system