KEGG   Anolis carolinensis (green anole): 100562455Help
Entry
100562455         CDS       T01608                                 

Definition
acyl-protein thioesterase 2-like
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100562455
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100562455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 232 aa AA seqDB search
MCGNNMSVPLLADAVTISGAERETAAVIFLHGLGDTGHSWAEALSAIRLPYVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAPEDETGIKKAADNIKAVIEHEIRNGIPANRIILGG
FSQGGALSLYTALTCQHQLAGIVGLSCWLPLHKTFPQAASNSMNKDTPILQCHGEMDPMI
PVRFGALTSEKLKCMVNPSKIQFRTYPGVMHSSCPQEMLAVKEFMEKVIPRI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtaacaacatgtctgtccccctccttgctgatgccgtgaccatttcaggggca
gagcgggagactgcagcggtcatttttttacatgggcttggagacacagggcacagctgg
gctgaagccctgtctgccatccggctcccttatgtgaagtacatctgccctcatgcgccc
aggatcccagtcactctcaacatgaagatggtcatgccatcctggtttgatctgatgggc
ctcagtccagatgcacccgaagatgaaactgggattaaaaaagctgctgacaacattaaa
gcagttatcgagcatgagataaggaacggcatcccagccaaccgcatcatcttggggggc
ttttcacagggtggtgcactgtccctctacacggcactcacttgccaacaccaactggcc
ggcatcgtgggcctcagctgctggctccccctgcacaagactttccctcaggcggcaagt
aacagcatgaacaaagacacccccatcctgcagtgccatggggagatggaccccatgatc
ccagtacgcttcggagccctgacctccgagaagctgaagtgtatggtgaatcccagcaag
atccagtttagaacctacccaggagtgatgcacagctcttgccctcaggaaatgttggct
gtgaaagaattcatggagaaagtcatccccaggatttga

DBGET integrated database retrieval system