KEGG   Anolis carolinensis (green anole): 100562544Help
Entry
100562544         CDS       T01608                                 

Definition
pyruvate dehydrogenase [lipoamide] kinase isozyme 3-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 406 aa AA seqDB search
MRLCGALLKSPIPKQIEYYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANT
MREVNLLPDNLLNRPSVKLVQSWYMQSFLELLEYENKSPEDPHVLDNFLDILIKVRNRHN
DVVPTMAQGVIEYKEKYGFDPFVSSNIQYFLDRFYTNRISFRMLINQHTLLFGGVTNPAH
PKHIGSIDPTCNVADVVEDAFATAKMLCEQYYQAAPDLEIEEFNAKAPGKPIQVVYVPSH
LFHMLFELFKNSMRATVELHEGKCESYPSIKALVTLGKEDLSIKISDKGGGVPLRKIDRL
FNYMYSTAPRPSLEPSRAVPLAGYGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKA
LSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKANR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcggctatgcggggcgctcctcaagagccccatccccaaacagatcgagtactactct
cgcttttccccctcgccgctctccatcaaacagttcctcgacttcgggcgtgataatgca
tgtgagaaaacatcttatatgttcctgagaaaagaacttcctgtacgacttgcaaatacc
atgagggaagtaaatttgttgcctgacaacttgctgaatagaccttcagttaaactagtt
cagagctggtatatgcagagctttcttgaacttttggaatatgaaaacaaaagtcctgaa
gatccccatgttttagataactttttagatatcttaattaaagtcaggaacagacacaat
gatgttgttcctaccatggctcaaggagtgattgaatacaaggaaaagtatggctttgac
ccctttgtaagcagtaacatccagtattttctagataggttctacaccaaccgcatctca
tttcgcatgcttattaatcagcacacactgctttttggtggagtcactaatcctgctcat
cccaaacatattgggagtattgatcctacatgtaatgtggctgatgtggtagaagatgcc
tttgcaactgctaagatgttgtgtgaacagtattatcaggctgcacctgatttggaaatt
gaagaattcaatgctaaagcaccaggcaagcctattcaagtagtctatgtgccctcacat
ctgtttcatatgctttttgaattgttcaagaactctatgcgagctacagtggagttacat
gaaggcaaatgtgaaagctatccatcaattaaagccttagtcactttgggtaaagaagac
ctttcaataaagataagtgataaaggtggtggtgtgcctctgaggaaaatagaccgtctt
tttaactatatgtattcaacggcacccaggcctagtttggaaccatcaagagctgttcct
ttggctggatatggatatggcctgccaatctctcgtctttatgctagatattttcaaggt
gatctcaaactatactcaatggaaggtgtgggaactgatgctgtaatttatttgaaggct
ctttccagtgaatcatttgaaaggttacccgtttttaataagtcagcctggcgacattac
aagaccaccccagaagctgatgactggagcaacccgagcagtgaacccagggatgcatcc
aaatataaagcaaatcgataa

DBGET integrated database retrieval system