KEGG   Anolis carolinensis (green anole): 100562588Help
Entry
100562588         CDS       T01608                                 

Definition
mitogen-activated protein kinase 15-like
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 539 aa AA seqDB search
MGSVAIAMERPDNNNPLPDPGELCHPRWAAGRTPTSGGGPVVSLGGQRTFREIAFLQEFG
AHPNIIKLLNVIRAQNDKDIYLVFESMETDLHAVIKKGNLLKDIHKCYILYQLLKATKFI
HSGDVIHRDQKVSGVLDASSNEPLHRGVDMWSIGCILGEMLLGKPLFPGSSTINQIEQIL
RVVPAPGPEDVAAFHSDYRASLLSRLSDQQRVTFEELLPPSTPPQALDLLKRLLAFNPEK
RPTAEEALEHPYVRRFHSPAREPSLRGSVVLPLDDNVQLSVAEYRNKLYEMILEKKAQNQ
RQKQQQQPPRPQSQEDPRPAPPEPTAPHGAPAEAQEAPGPLPPQGPLGAPAPSAAPPHRA
GWAKGGSAAARGGLVPGSLARNRSAPLLPQAQARQQEAAASLGRRGRRRGSCPPGSAQPA
PQGAPHSLEGGLLAPRAPFSLSAQAHQLALHQPLMRKEPSPSKAPVPPGENVKSGESRGR
GALPLPKPCKKLFRGTANVGAAGDPKACLGSYSQSYGTICKSALQSLPLAGVCPQGAGL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggggtcggtggccatagcaatggagcgtccggacaacaacaatcccctccccgaccca
ggcgagctgtgccacccacgctgggctgcaggcaggaccccgacgtcgggagggggtccc
gtggtttctttggggggtcagaggaccttccgggagatcgccttcctgcaggagttcggt
gcgcaccccaacatcatcaagctcctgaacgtcatccgggcgcagaatgacaaggacatt
tacctggtctttgagtccatggagaccgacctccacgctgtgatcaagaagggcaacctg
ctgaaggacatccacaagtgctacatcctctaccagctactgaaggccaccaagttcatc
cactctggagacgtcatccacagggaccagaaggtaagtggggttctggatgcatcttca
aatgaaccactccatcgaggggtggacatgtggagcatcggctgcatcctgggggagatg
cttctcgggaagcccctgtttcccggctcctccaccatcaaccagatcgagcagatcctg
cgcgtggttcctgccccgggtccagaagatgtggccgccttccattcagactatcgagcg
tccctcctcagccgcctgagtgaccagcagcgggtgacctttgaggagctcctcccgccc
tccacgcccccccaggccctggaccttctcaagcggctcctggccttcaaccccgagaag
cggccgaccgcggaagaggctctggagcatccctacgtgcgcaggttccactctccggcc
agagagccctccctccgcggcagcgtggtccttccgctggacgacaacgtgcagctctcc
gtggccgagtaccgcaacaagctctacgagatgatcctggaaaagaaggcccagaaccag
cgccagaagcagcagcagcagccgccccggcctcagtcgcaggaggatccccgcccggcc
cccccagagcccaccgccccccacggggccccggcagaggcccaggaggcaccggggccc
ctcccaccccaggggcctttgggggcccccgccccctctgccgctcccccgcacagggcc
ggctgggccaagggtggctccgctgcagcccgtggaggcctggtgccagggagcctggcc
aggaaccgctcggccccgctccttccgcaggcgcaggcacggcagcaagaggcggcagct
tcgctgggccggagaggccggaggcgggggtcctgcccccctgggagcgcccagcccgcc
ccccaaggggcgccgcacagtctcgagggggggctcctggccccgcgggcccccttctct
ctctctgcccaggcccaccagctggctctccaccagcccctgatgcggaaggagccctcg
cccagcaaggcccccgttccaccgggggagaatgtgaagagcggcgagtcgcgcggccgg
ggggcgctgcccctcccgaagccctgcaagaagctcttccgggggacggccaacgtgggc
gcagcgggggaccccaaggcctgcctgggcagctactcccagtcctatggcaccatctgc
aagtccgccctccagagcctccctctggccggcgtttgccctcagggtgccggcctctag

DBGET integrated database retrieval system