KEGG   Anolis carolinensis (green anole): 100562609Help
Entry
100562609         CDS       T01608                                 

Gene name
cpb1
Definition
carboxypeptidase B
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     100562609 (cpb1)
Peptidases [BR:acs01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   100562609 (cpb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 417 aa AA seqDB search
MWGLLLFLSATSAFANVSVHKFEGDKVFRVTPHNEEQVGILEYLASNFQVDFWKPDSVAQ
VKAEMTVDFRTEVDKSAEVEDILQQNNLDYEVLIDNLQSVLDGQFDNRVRAAGHNYEKYN
RWELIEAWTANIANENPTLVSRSQIGTTFEGRPMHLLKVGVPGGNKKAIFMDCGFHAREW
ISPAFCQWFVRQAVRTYGKETIMTQLLDKLDFYVLPVLNIDGYVYTWEKSRMWRKTRSVN
PGSSCIGTDPNRNLDAGWCTLGASKRPCDDTYCGSAPESEKETKALANFIRQNLSTIKAY
LTIHSYSQLLLFPYSYTYDVTKDNVELNRLAKATVQELATVHGTKYSYGPGATAIYPAAG
GSDDWAYDQGIKYSFTFELRDTGRYGFALPESQIKATCEETLVAVKYIASYVLDHLY
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtggggcttgctgcttttcctaagtgctacatctgcttttgccaatgtttctgttcac
aaatttgagggggataaagtttttcgtgtaacccctcacaatgaagaacaagtaggcatc
cttgaatacttggccagcaattttcaggttgatttctggaaaccagattctgttgctcaa
gtcaaagcagaaatgactgttgacttccgaactgaagtggacaaatctgctgaagtagaa
gatattctgcagcaaaacaacctggactatgaagttttgattgataaccttcaatccgtg
cttgatgggcagttcgacaaccgtgttagagctgctggacacaattatgaaaaatataac
agatgggaactgatagaagcttggacagctaatattgcaaatgagaacccaactcttgtt
tcccgatcacagatagggacaacttttgagggacgcccaatgcatctcctgaaggtggga
gtacctggtgggaacaaaaaagccatatttatggattgtggctttcatgccagagagtgg
atctcacctgctttttgccagtggtttgtaagacaggctgttcgaacctatggaaaagaa
accattatgacccaacttctggacaaactggacttctatgttttgcctgtcttgaatatt
gatggctatgtctatacctgggaaaagtctcgcatgtggaggaagacacgttctgtaaat
cccggcagtagttgcattggtacggatcccaacagaaatttggatgctggatggtgcact
cttggtgcatcaaaaaggccatgtgatgacacttactgtggcagcgcacctgaatcagag
aaggagaccaaggccttggctaacttcattcgccaaaacctctcaaccatcaaagcttac
ttgaccattcactcttattctcaactgctgctgtttccatattcttatacttatgatgta
acaaaggacaacgtggagttgaatagacttgctaaagctactgttcaagagctagccaca
gtgcatgggacaaaatactcatatggtccaggagctacagctatctatcctgcagctggt
ggctctgatgactgggcatatgaccagggcatcaagtattctttcacctttgagcttcgt
gatacaggtcgatatggttttgctcttcctgaatctcagatcaaagcaacttgtgaagag
accttggttgctgttaagtacattgccagctatgtccttgatcatctgtactaa

DBGET integrated database retrieval system