KEGG   Anolis carolinensis (green anole): 100562672Help
Entry
100562672         CDS       T01608                                 

Gene name
usp19
Definition
ubiquitin specific peptidase 19
Orthology
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100562672 (usp19)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100562672 (usp19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1428 aa AA seqDB search
MSSSASVPGQRRTARGADDATNKKKQKDRANQESKEGERPVGSDSKKEPFPGLELVEPNW
QRESEEDLLLDWKQNADEVIIKLSLGGGIPKTEEVDASFTDTSCFIRLPGGRQWSCQFYE
EIESSCSKVQYKKGNILQLVLQKKIPLHTWASLLKRCKDGSRDQTKRVCKENGKEKPPSV
ENITEDPLSCSITESSRAKRELSNPKRAPGRSESAGGKNPSSPGLPTGPSAKRAVCTKTS
FLEGEENHSSMENTGLCGEADSQRSDQGAQGDAILHLKGEKTERESVPMEMQASVAPSDV
LPSPLRPGLEERIPEPASSCETPSEAVSATSKDLSSSLPSSDTEKSGLTKEKDALNAVAN
EPEPTVNLTFVKNDSYEKGNDSMVVHVYVKEIHKEMSRVLFREQDFTLLFQTSDVNFLRL
HPGCGSHTIFRWQVKLRNLIEPDQCTYNFTTARIDICLKKRHSQRWGGLEAPATRGAVGG
AKVAMPTGPTPLDKSQPGSNQHPLSTKEEARAGEKEKPRAEDGGLDGVAARTVSEHMPVK
QEPLVPSPKPTCMVPPMTHSPVSSESVEEEEEEEDKKVCLPGFTGLVNLGNTCFMNSVIQ
SLSNTRELRDYFHDRSFESEINYNNPLGTGGRLAIGFAVLLRALWKGTHHAFQPSKLKAI
VASKASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETVDSDGRPDEVVAEEAWHR
HKMRNDSFIVDLFQGQYKSKLVCPVCSKVSITFDPFLYLPVPLPQKQKVLTVYYFAKEPH
KKPVKFLVSISKENSTAMEVLDSVSHSVRVNPENLRLAEVIKNRFHRMFLPSHSLDAVSP
SDLLLCFEVLSPDLAKERVVELQVQQRPQVPSVPITKCAACQKKQQSEEEKLKRCTRCYR
VGYCNVVCQRTHWSDHKTLCRPENIGFPFLISVPESRLTYARLAQLLEGYARYSVSVFQP
PFQVGRMSPEQGLQHPEKQEPSARNSSATASAASDSTSTLESGDGARAPHLLSEPQASFS
GPELQPELGDVSVVRSKITPGRSSGLNLDSGMSETLVTSRTETCMELPFMELPRTSKPEA
AIPGYQHSAEGLSSHVTQFYINKIDASSKEQKLEDKGDIPLDLTDDCSLALVWKNNERMK
EFVLVESKDLECVEDPGSASEAARAGHFTLEQCLNLFTKPEVLAPEEAWYCPKCKQHREA
SKQLMLWRLPNVLIIQLKRFSFRSFIWRDKINDMVDFPVRSLDLSKFCIGQKDEQQLPMY
DLYAVINHYGGMIGGHYTAYARLPSDKNSQRSDVGWRLFDDSTVTTVDESQVVTRYAYVL
FYRRRNSPVERPPRGPLHPSDPRADLAPSAEAAANQASLLWQELEAEEEAARRLLRNPWR
SGSRGSMDLAPECPDESHVRYFVLGTMAAIVALFLNVFYPLIYQTHWR
NT seq 4287 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtagtgccagtgtccctggtcagaggagaaccgcacggggagcagatgatgca
accaacaagaaaaaacagaaggaccgagctaatcaggagagcaaggagggcgagagacca
gttggcagtgactcaaagaaagagccctttcccggcctggaactggtagagcctaattgg
cagagggagtcagaggaggatctcctgctggactggaagcagaatgctgatgaggttatc
ataaagttgagcctgggcggtggcattccaaaaacagaggaagtggatgcttctttcaca
gacaccagttgtttcataagattacctggtggtcgccagtggagctgtcagttttacgag
gaaattgagagctcttgtagcaaagttcagtacaagaaaggcaatatcctacaactggtg
ctgcagaaaaagatcccactccacacgtgggcttcactgttgaaacgctgcaaggatggc
tcaagagaccagaccaaaagggtgtgcaaggagaatggtaaggagaaacccccttctgtg
gaaaacatcactgaggatcctctatcttgtagcatcacagagtcgtccagggctaaacgg
gagctctccaacccaaagcgagctcctggaaggagcgaaagtgcaggaggaaagaaccca
tccagcccagggctgccaactggcccgagtgccaagcgggcagtgtgcaccaaaaccagt
ttcttggagggtgaagagaatcacagcagcatggaaaacacaggactctgtggggaagct
gacagtcaaaggagtgatcagggagctcaaggggatgctatattgcacttaaagggtgaa
aaaacagagagggaatcggtgcccatggaaatgcaggcctctgtggctccttcagatgta
ttgccttctccactcagacctggtttagaagagaggatcccagagccagccagttcttgt
gagactccatcagaagctgtatctgccaccagcaaagatctctcttcctctctaccaagt
agtgatactgaaaagagcgggttgaccaaggagaaggatgctctaaatgctgttgctaat
gaaccggagcccactgtgaatttgacgtttgtgaagaacgattcctatgagaaggggaac
gattctatggtggtgcatgtttatgtgaaggagattcacaaggagatgtccagggtgctc
tttcgggagcaagacttcacattactattccagacaagtgatgtcaacttcctgcgactg
catcctggctgtggctctcatacgatattcaggtggcaagtaaaactcaggaatctcata
gaaccagaccagtgcacctataatttcaccactgcccgtattgacatctgcctgaagaag
cgacatagccaacgctgggggggcctggaagctccagccacacgaggtgcagtgggtggt
gcaaaggttgccatgccaaccggtcctacccccttggataaaagccaacctgggagtaac
cagcaccctctctccaccaaagaagaagctcgagcaggtgagaaggagaagccacgggca
gaggatggtggcctggatggcgttgctgctcggacagtgtcggaacacatgccagtgaag
caggagccgcttgtgccctcgcccaagccgacatgcatggtcccacccatgactcacagt
cctgtcagcagcgagagtgtggaggaagaggaggaagaagaggacaagaaggtgtgcttg
ccaggtttcacaggactagtgaacctgggcaacacctgtttcatgaacagtgttatccaa
tctctgtccaacacacgggagttgcgggactactttcatgatcgctcctttgaatctgag
atcaactacaacaatccactgggaactggagggcgactggctattggctttgctgtgctg
ttgagagcactctggaaaggtactcaccacgccttccagccttccaagctaaaggcaatt
gttgccagcaaggcaagccagtttacaggttatgcgcaacacgatgcccaagaattcatg
gcttttctattggatgggctacatgaggatctgaaccgcatccagaacaagccctacaca
gaaacagtggattcagatggacggccagatgaggttgttgcagaagaggcctggcaccgg
cacaaaatgaggaatgactccttcattgtggacctcttccagggccagtacaagtccaag
ctagtgtgtcctgtatgctcaaaggtgtccatcacgtttgatcccttcttgtatttgcca
gtcccccttccccagaagcagaaagtgctgacggtttattattttgcaaaggaaccacac
aagaaacctgtcaagtttcttgtgagtatcagcaaggagaactccacagccatggaggtg
ctggactctgtgtcccatagcgtgcgagtgaatcctgagaacctgcgtttggctgaggta
atcaagaaccgatttcatcgcatgttcctgccttcccactcgttggatgcagtctctccc
tcagaccttctgctgtgctttgaggtgctttctccagacctggccaaggagcgggtggtg
gagctgcaggttcaacagcgtcctcaggtgcccagcgtgcccatcaccaaatgtgccgct
tgtcagaagaagcaacagtcagaagaagagaaattgaagcgctgtactcggtgctaccgt
gttggctactgtaatgtagtgtgccagagaacccactggtctgatcacaaaacattgtgc
cgccctgagaacattggcttccccttcctcatcagtgtgccggagtcacgcctcacctat
gcacggctagcccaacttctggaaggttatgcaagatactcggtcagtgtatttcagcca
ccattccaggtgggcaggatgtcacctgaacaaggcttacagcatcctgagaaacaagaa
ccttctgccaggaatagtagtgcgactgcttctgctgctagtgacagcactagcactctg
gagtcaggagatggtgctagggccccacatctcttgtcagaaccccaggcatctttctct
ggtcctgaactacagcctgagttgggggatgtcagtgtggtgaggagcaagatcacccca
ggaagaagctcaggtctgaacttggattcaggcatgtctgagactttggtgacctcgcgg
actgagacctgcatggagctgcctttcatggaactaccaagaacctccaaacctgaagct
gcaatacctggttaccaacattcagcagagggcctaagttcccatgttacccagttttac
atcaacaagattgatgcttccagcaaagagcagaaactagaggataaaggagatatccca
ctggacctgacagatgactgttctctggccttggtttggaaaaataatgagcggatgaag
gagtttgtactggttgaatccaaggacctggagtgtgtggaagatccaggctctgcaagc
gaagctgccagggcaggacacttcacccttgaacagtgcctcaacctcttcaccaagcca
gaggtcttagcccctgaggaggcctggtactgcccaaagtgtaagcagcaccgtgaagca
tctaagcagctcatgctgtggcgtctgcccaatgtcctcatcatacagctcaagcggttc
tccttccgtagctttatttggagggacaagatcaatgatatggtggacttccctgtcagg
agcttggacctgagcaagttctgtattggtcagaaagatgagcagcagctacctatgtat
gatctgtatgcagttattaatcactatggaggcatgattggcgggcattacacagcttac
gccagattgcctagtgacaagaacagccagcgtagtgacgtgggttggcggctctttgat
gacagcacagtcactacagtagatgaaagccaggtggtgacacggtatgcctatgtgctc
ttctaccgtcgacggaactctcctgtagagagacccccaagagggccacttcacccctcg
gaccctcgggctgacttggctccctctgctgaggcagcagccaatcaggcttctctgctc
tggcaggaactggaggcagaagaggaagctgccaggaggctcttgaggaacccttggagg
tctggcagccgaggatcaatggaccttgccccagagtgtcctgatgaaagccatgtccga
tactttgtcctgggcaccatggcagccattgtagcactcttcctgaatgtcttctacccg
ctcatctatcagacccattggaggtag

DBGET integrated database retrieval system