KEGG   Anolis carolinensis (green anole): 100562694Help
Entry
100562694         CDS       T01608                                 

Definition
(RefSeq) cytochrome P450 4B1-like
  KO
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100562694
Cytochrome P450 [BR:acs00199]
 Cytochrome P450, animal type
  CYP4 family
   100562694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 515 aa AA seqDB search
MNTVLESVNNSWLPRDSSQIFHLVLLLSFTYVILKVIKVFWRRQQDINALRCFPLPPTHW
LYGHVHKMSPEEEFLTTAAWAEKYPQCHQLWFGQFLYALYINHPEYAKVVFSKNDPKVLL
VYGFLIPWIGKGLLILNGPKWQQHRKLLTPGFHYDILKPYINVMVESVKQMLDILEKQVS
KDSTASVEIFKHVSLMTLDTIMKCAFSNKSNCQTERDNAYIKAVYDLTYLFDQRLKSPLL
HNDFTFQFSSQGRRFYNACKIAHHHTDNVIRERKESLKNEKELEKILKKRRLDFLDILIC
AKDENGNSLSDEDLRAEVDTFMFEGHDTTASGISWLFYCMAQNPEHQQRCREEITELLGK
EGHIQWDDLGKMPYVTMCVKESLRLYPPVYQIGRELNVPVTFPDGRTIPKGIFVILGINT
LHRNPEVWENPEVFDPLRFSPENSSRRHPFAYLPFAAGPRNCIGQQFAMNELKIALALTL
LRFELLPDNSQPPIPIPQTVTRSKNGIHLKLKSIH
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgtactggagtctgtcaataattcttggctgcctcgggattcctctcagatt
ttccatctagtacttcttctgagcttcacctatgtcatcctgaaagttatcaaagtgttt
tggcgcagacagcaagatatcaatgctctccgatgttttccattgcctcccacacactgg
ctgtacggtcatgtccacaagatgtcaccagaggaagagttcttgactacagcagcctgg
gcagaaaaatacccacaatgtcatcagctatggtttggacaatttttatatgccttatac
atcaatcatcctgaatatgcgaaagtggtctttagtaaaaatgatcctaaagttcttcta
gtatatggcttcttaattccatggattggaaagggcttgttgattctgaatggtcctaaa
tggcagcaacatcggaagctgctgactccaggcttccattatgatattctcaagccttac
atcaatgttatggttgaatcggtcaagcaaatgctggatatcctggagaagcaggtatca
aaagatagtacggcatcagtggagatattcaaacatgtcagtctgatgactcttgatacc
atcatgaaatgtgccttcagcaataagagtaactgtcaaacagaaagggataatgcctat
attaaggctgtctatgaccttacctacttgtttgatcagaggctgaagtcgccattgctc
cacaatgacttcaccttccagtttagctcccaggggcgccggttttacaacgcttgcaaa
atagcccatcatcacacagacaatgtaataagggagagaaaggagtcccttaagaatgag
aaagaacttgagaagatcttgaagaagaggcgtttagacttcctagatattcttatttgt
gcaaaggatgaaaatgggaattcattgtcagatgaagacttgcgtgccgaagtggacaca
ttcatgtttgaaggtcatgacaccacagctagtggcatctcttggctcttctattgtatg
gcccagaatcctgaacatcagcagagatgcagagaagagataacagaacttcttggcaaa
gaggggcatatacaatgggatgacctaggaaagatgccatatgtcaccatgtgtgttaaa
gagagccttcgactttacccaccagtctaccaaatagggcgagaactaaatgtgcctgtg
acatttccagatggaagaacaataccaaaaggaatttttgttatattgggtattaatacc
cttcaccgaaatcctgaggtctgggaaaatcctgaggtctttgatccgctaagattttcc
ccggaaaattcaagtcgtcgccatccttttgcctatcttccttttgctgctgggccaagg
aactgcattggacaacaatttgccatgaatgagttgaaaattgctctcgccttgacactt
ctgcggtttgaacttctgcctgataattcccagccccccattcccatcccacagactgtt
acccgatccaagaatggaatacacctgaagctgaaatctattcactga

DBGET integrated database retrieval system