KEGG   Anolis carolinensis (green anole): 100562844Help
Entry
100562844         CDS       T01608                                 

Definition
protein-glutamine gamma-glutamyltransferase 2-like
Orthology
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100562844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 531 aa AA seqDB search
MPSAFCRARTIQRCLFILFSIFSQFEEGIVDICLQLLDTNPKFLLNQDKDCSRRNSPVYV
SRVVSAMVNCNDDNGILYGRWDNQYEDGMSPLSWNGSVDILRRWEKFGCQPVRYGQCWVF
AAVACTVLRCLGIPTRVVTNFESAHDTNSNLIIERYMDQNGKRQPGSRDSIWNYHCWVES
WMGRPDLAAGYDGWQALDPTPQEKSEGVFCCGPAPVKAIKEGDLHVKYDVPFVFAEVNAD
VVNFVLQDDMSWKKTTYTSLVGMKISTKRVGSDTREDITHHYKYPEGSREERAVFAKALH
RKDPAPAKGGLKVRIKASEGINNGCDFKVFAVLVNNTAEEHRCRLRFGTHVISYNGALGP
EISFKDLRNITLEPYAERTVPLRILYEKYGHCLTQDNMIKVTALLTDLGTQEVVLGIRSI
YIKNPDIKIRVLGEPMQKRKLVAELTLTNPLPTPLTGCVFTVEGAGLTDGQKVQEIESPI
GPGEEAKVRVDFVPRRSGLRKLVVDFESDKLKGVKGYQDVIIAPPPKWSRP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtgccttttgcagggcaaggaccatacaaaggtgtttgttcatcctgttttcc
atcttctcccagtttgaagaagggattgtggacatctgcctgcagctgctggacaccaac
cccaaattcctcctcaaccaggacaaggactgctcccgccgcaacagccccgtctacgtc
agccgagtggtcagcgccatggtgaattgcaatgatgacaatggcatcctctatggacga
tgggacaaccagtacgaggatggcatgagtcccttatcctggaatggaagtgtggacatc
cttcggaggtgggagaagttcgggtgccaaccggtccgttatgggcagtgctgggtcttt
gccgctgtggcttgcacagtgctccggtgcctgggcatccccacccgcgtggtcaccaac
ttcgagtctgcccacgacaccaacagcaacttgatcatagagcgatacatggaccaaaat
gggaagaggcagccgggcagccgggactccatctggaattatcactgctgggtcgaatct
tggatgggacgtccagatcttgcagcagggtatgatgggtggcaggctttggacccaact
ccccaggagaaaagcgaaggtgttttctgctgcggaccagcacccgtcaaagccatcaaa
gagggagaccttcatgtcaagtatgacgtcccctttgtcttcgccgaggtcaatgccgat
gtggtgaattttgtgctccaggatgatatgtcctggaagaagaccacctacaccagcctg
gtgggcatgaagatcagcaccaagagagtgggcagtgacaccagggaggacatcacccat
cactacaagtaccccgaaggatcgagggaagagcgagccgtctttgcaaaggccctgcac
cgcaaagacccagcaccagcgaagggaggactgaaggtcaggatcaaagcctccgagggc
atcaacaatggctgtgacttcaaagtcttcgctgtcctcgtcaacaacacggcagaggag
caccggtgccgcctgaggtttggcactcatgtcatcagctacaatggggcgctgggtccc
gaaatcagtttcaaagacctgcgtaacatcacgctggagccatatgccgagcggactgtc
cctttgcgcatcctctatgagaagtacggacactgcttgactcaggacaacatgatcaag
gtgacggctctcctcactgacctcggcacccaggaggtggtcctcggcatccggagcatc
tacatcaagaacccggatatcaaaatcagggtcctgggggagccgatgcagaagcggaag
ctggtggccgaactgacgctgaccaacccactgcccacccctctgaccggctgcgtcttc
accgtggaaggggccggactcacggatggacagaaggtccaggagattgagtctcccatc
ggtccgggcgaagaagccaaagtgagggtggactttgttccccgacggtctggtttgagg
aaattggtggtggacttcgaaagcgacaagctgaaaggggtgaagggctaccaggacgtc
atcatcgctccaccacccaagtggagcaggccataa

DBGET integrated database retrieval system