KEGG   Anolis carolinensis (green anole): 100562853Help
Entry
100562853         CDS       T01608                                 

Definition
HRAS-like suppressor 2
Orthology
K16817  
HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100562853
   00565 Ether lipid metabolism
    100562853
   00590 Arachidonic acid metabolism
    100562853
   00591 Linoleic acid metabolism
    100562853
   00592 alpha-Linolenic acid metabolism
    100562853
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100562853
    3.1.1.32  phospholipase A1
     100562853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 175 aa AA seqDB search
MSEGYCMDRRTGHWVVPKPGDLIEISRLGYQHWAVYVGSGYVIHLASSGDFVKASTNSLL
SVMTEKAMVKKELLTDIVRGDDYCVNNKYDDRCRPLPANKIVQEAEELLGEEMHYSVTSN
NCEHFVTRLRYGTARSDQVRDAVIAGTVGLVGVGAMVVLAGVIGSLLSPRNQEKK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaggatattgcatggacagacggacagggcattgggttgtgcccaagcccggg
gaccttattgagatttcccgcttgggataccagcactgggctgtctatgtgggatctggt
tacgtgatccacttggcttcctctggtgacttcgtaaaagccagcacaaacagcctcctg
tcggttatgacggaaaaagccatggtgaagaaggaactgctgacggacatcgttcggggc
gatgactattgcgtcaacaacaaatatgatgacagatgccgcccgcttcccgccaacaaa
attgtccaggaggcggaagagctcttgggagaggaaatgcactacagcgtgaccagcaat
aactgcgaacactttgtcaccaggctccgctatggcacagctaggagcgaccaggtgaga
gatgccgtgattgctggcactgttggattggtcggtgttggggcgatggtcgttttggca
ggcgtgattggcagcctgttgtcgcccaggaatcaggaaaagaaataa

DBGET integrated database retrieval system