KEGG   Anolis carolinensis (green anole): 100562867Help
Entry
100562867         CDS       T01608                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100562867
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100562867
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 310 aa AA seqDB search
MALAEVVVVGSCMTDLVSLTPRLPKAGETIHGHKFFTGFGGKGANQCVQAARLGAKTSMI
CKVGKDSFGNDYIENFKKNGIPTEFVNQVEDAATGAASIVVNSEGQNFIVIVAGANLLLN
SNDLKKAAHVISKAKVVVCQLEVTPAISLEAMKMAHASGVKTLFNPAPALADLNPEFYTH
SDIFCCNESEAEILTGITVGNAEDAGRVGCILLERGCKTAIVTLGPEGCVMVSKNAPTPK
HVPAQKVTPVDTTGAGDSFVGALAFYLAYYPHLPLEEMLKRSNCIASISVQTTGTQTSYP
YRKNLPQNLF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcactggctgaggtcgtggtggtgggatcctgtatgactgatctggtgagtcttact
ccacgtctgccgaaagctggagagaccatacatggacataagtttttcactggatttggg
gggaaaggtgccaaccagtgtgtgcaggctgctcgacttggagctaaaacctcaatgatc
tgcaaggttgggaaagattcctttggtaatgattatattgaaaacttcaagaaaaatggg
attcctacagagtttgtaaaccaagtggaagatgctgctactggagctgcttcaattgtg
gtcaatagtgaagggcaaaactttattgtcattgttgcaggagcaaatttgcttttaaat
tctaatgacttgaagaaggctgctcatgtcatctcgaaagccaaagtggtggtttgccag
cttgaagtcactccagcgatttctctggaagctatgaaaatggctcatgccagtggagtg
aagactttgtttaatccagctccagcacttgctgacctaaatccagagttttatacccat
tctgacatcttctgttgcaatgaaagtgaggcagaaattctaacgggcattacagttggt
aatgctgaagatgctggacgtgtgggatgtatcttgttagagcgaggctgcaagaccgcc
attgtaaccttgggcccagagggttgtgtcatggtctccaaaaatgcacccactccaaaa
catgttcctgctcagaaggtcacccctgtggataccacgggagcaggtgatagctttgta
ggagccctggctttctacctggcctattatccccatctacctttggaggaaatgctgaag
aggagtaactgtattgcatctattagtgtgcaaacaacggggacacagacatcatatccc
tacagaaagaacctgccacaaaatctcttttaa

DBGET integrated database retrieval system