KEGG   Anolis carolinensis (green anole): 100562869Help
Entry
100562869         CDS       T01608                                 

Gene name
lamb2
Definition
laminin, beta 2 (laminin S)
Orthology
K06243  
laminin, beta 2
Organism
acs  Anolis carolinensis (green anole)
Pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100562869 (lamb2)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100562869 (lamb2)
Cell adhesion molecules and their ligands [BR:acs04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      100562869 (lamb2)
   VLA-6
      100562869 (lamb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1793 aa AA seqDB search
MPVQHCHCVSYSLLLQSSLIFHVPAVLGGALCQDPEHPHGCSQGSCYPSTGDLLVGRADR
LSATSTCGLRHRQPYCIVSHLQDEKKCFVCDSRRPYDPTSNPNSHRIENVITTFAPHRKK
AWWQSENGVEQVSIRLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWQVYRYFAYD
CAASVPFASRGPLRRVDDVICESRYSDIEPSTEGEVIYRVLDPAIHIRDPYGPKIQNLLR
VTNLRVNLTKLHTLGDNLLDSRREIKEKYYYAVYEMVLRGNCFCYGHASECAPLAGSPAD
VEGMVHGRCVCKHNTKGLNCEQCDDFYHELPWRPAEGRRTNACKKCNCNEHSYRCHFDMA
VYLATGNTSGGVCDECQHNTMGRNCQLCKPFYYKDPTKDIRDPNVCHACDCDPDGTLDGG
VCDTHDDPTLGLIAGQCRCKEHVQGARCDKCKPGFFGLNADNPQGCQRCQCDPRGTVQDG
PQCDAITGDCFCKRLVTGRSCNQCLPEHWALSPDLHGCRPCECDVGGAHDNQCATETGQC
RCRSHMVGRQCSQVQTGYFHIMLDHYTYEAEEAELHQGAEVVERMHLTGRPATWTGVGFV
RVLEGNVVSFRIDNVPFTMEYDILLRYEPQLPGKWEVKVSVIRPGPILTSSPCGNTIPAD
DVMSTSLPPASRYVVLAQPVCLEQGVSYTIRVEFTRYGGHEPLQGASILLDSLVLMPRYS
SLEMFIAGDPASIARKEIFERYRCVQQARPVIKAPTPEPCAHLLTSMSAVIHQGALPCLC
SPQGSLSSECNPVGGQCQCKSHVVGRRCERCFPGTFGFGPAGCRACQCSPEGSLSGFCDN
FSGQCPCRPGAFGLRCNHCQPVHWGFPNCRPCQCNGRSEECDPQTGSCLHCRGHTEGDRC
QSCVSGYYGNPVLASGGHCRPCPCPEAPGSGRHFAATCHQDSRSGSVICSCLAGYTGPRC
DECAPGYYGNPWQARGRCQPCACNNNIDVGDPTSCDRRTGQCLRCLYNSEGDQCQFCQGG
YYGDATRRTCRRCSCNFLGTARSECPSRDQCQCERYSGQCRCLPNVQGQNCDHCAPNFWN
IASGQGCQPCDCHPQYSLSSACNQFTGQCQCRPGFGGQTCSECQENHWGEPNQQCRVCDC
DPRGIEKPQCHRITGHCSCRPGVSGVRCDQCSRGFAGEFPACQPCHKCFGDWDRIVQDLA
GRTRALVQRAQQLQQTGVTGAFEGPFRRLQEKLSAAQTIVNARNATASAITHLLQNMDEL
RQEIADITETLTRLEGFLTATQDKNFNANHALGTLERGARGLNLSLADLSRQLEALMNAN
VLGAYDSVRQSYAQSREAEHRANTSTLAVPSPVSQSAATRRRTEHLITTRRDAFNRQNAA
NRRGLTDLSTRVAGLSLHQINEKVCGAPGDVPCANSPCGGAGCRDEDGQRHCGGLNCNGA
VATADNALDRARHAEGELRRAVVDVDTLLRQVAEAKARAGEAKQRAQAALENANATKARL
ERSNKDLRDLIQQIKGFLNLEGADPDSIALVASRVLELSIPASPAQIHHLAEQIKERVSS
LANVDAILNQTAGDVRVAGDLLKEARRANARAEGVKNAAQSVKKALDDAKRAQNAAEKAI
RDAASDIHHTEDMVNRMQEKTANAEGQLVFAMERVGDLERQVDELKMKRANNILAATRAE
ETASAARERAGEAEQILDGPLSDQYRTMKELVEHKAQHVLGARQKAERLRDEAKGLLRDA
HDKLRRLSALEETYEENERLLQDKAAQLDGLEAKMRSILGDINQQIQIYNTCQ
NT seq 5382 nt NT seq  +upstreamnt  +downstreamnt
atgccagttcaacattgccattgtgtttcttattctctattacttcaatcttccttgatt
ttccatgttcctgcagtgctggggggagccctgtgccaagatcccgagcatccccatggc
tgttcccaaggcagttgctatccaagcacaggagatttgctggtaggtcgggctgaccgc
ctctccgccacctccacctgtggcctgcgacatcgccagccctattgcatcgtcagccat
ttgcaggatgagaaaaagtgctttgtttgtgactctcgccggccctatgatcccacgtca
aatcctaacagccatcggattgagaatgtgatcactacttttgcaccacatcgtaagaag
gcctggtggcagtcggagaatggtgtggaacaggtcagcatccgcttagatctggaagcc
gagttccacttcactcacctcatcatgacttttaagactttccggccagcagccatgttg
gtggagcgttcagcagattttggccgcacttggcaggtgtatcgctactttgcctatgac
tgtgcagcatcagtcccatttgcctcccggggacccttgaggcgggtggacgatgtcatc
tgcgagtcccgttactcagacattgaaccctccactgaaggagaggtaatctacagggtg
ctagacccagctatccacatccgggacccgtacggtccaaaaatccagaatcttctgcga
gtcaccaacctacgggtgaacttgaccaagctgcacaccctgggagacaacctgctggat
tcacggcgggagatcaaggagaagtactactatgccgtgtatgagatggtgctgcgaggc
aactgtttctgctatgggcatgcctccgagtgtgctcccctggctggcagccctgcagat
gttgagggcatggtgcatggtcgctgtgtctgcaaacacaacaccaaagggctgaactgt
gagcagtgtgatgacttctaccatgaactgccttggcgcccagctgaaggaaggcgcacc
aatgcttgcaaaaagtgcaactgcaatgagcactcgtatcggtgccactttgacatggct
gtgtacctggccacaggcaacacgagtggcggagtctgtgacgagtgtcagcacaacacc
atgggccgcaactgccagctctgcaagcccttctactacaaggaccccaccaaggacatc
cgtgaccccaatgtttgccatgcctgtgactgtgaccctgatggcacattggatggtggg
gtgtgtgacacacacgacgacccaacgctggggctcatcgcaggacagtgtcgctgtaag
gaacatgtgcagggagcccgctgtgacaagtgcaagcccggcttctttggactgaatgca
gacaacccacaaggctgccaacgttgtcagtgtgacccacgaggcacggtgcaagatggg
ccccagtgcgatgccatcacgggagactgcttctgcaaacggttggtgaccgggcgcagc
tgtaaccagtgtctgcctgaacactgggccttgagccctgacctacatggctgccggcct
tgtgaatgtgatgtaggaggtgcccatgataaccagtgtgccactgaaacaggacaatgc
cgctgccgcagccacatggtcggcaggcagtgcagccaagtgcagactggctatttccac
atcatgctagatcactacacatatgaagcagaagaggctgaacttcaccagggagctgaa
gttgtggagcgaatgcacctcacaggccggccagctacatggacgggagtgggctttgta
cgggtgctggagggcaacgtggtgtcatttcggattgataatgtgcccttcaccatggaa
tatgacatactgctgcgctatgaacctcagctgccaggaaaatgggaagtgaaggtgtct
gtgatacggcctggacctatcctcaccagcagcccatgtggaaacaccatccctgctgat
gacgtgatgtcaacatctttgccgcctgcatcacgatatgtggtgttggcacagccggtc
tgtctggagcaaggggtcagctataccatccgggtggagttcactcgctatggtggacat
gagcctttgcaaggtgcatctatactgctggactccttggtactgatgccacgttactcc
tccttggagatgttcattgctggggatcctgcctccattgcccgcaaggagatctttgag
cgctaccgctgtgtccaacaggctcgccctgtgattaaggcacccaccccagagccttgt
gcccatttactcaccagcatgtcagctgtcatccatcaaggggcattgccctgcttgtgc
agtccacagggctcattgagttcggagtgcaacccagttggtggtcaatgccagtgcaag
tcacatgttgtgggtcgccgctgtgaacgttgtttccctggcacctttggctttgggcct
gctggctgcagagcatgccagtgtagccccgaagggtccttaagtggcttctgtgacaac
ttcagtggacagtgcccatgccggccaggagcctttggccttcgctgcaaccactgccaa
ccagtccattggggttttccaaactgccgcccatgccagtgcaatggccgctctgaggaa
tgtgacccacagactggcagctgcttacattgccggggccacacagaaggagatcgatgc
caaagttgtgtctctggatactacggaaatccagtgctggcttcagggggccattgtcgc
ccctgtccctgccctgaggcccctggatctggccgacattttgctgccacttgccatcaa
gacagccgctctggaagcgtgatatgtagctgtctggcaggctatacaggcccccgctgt
gatgagtgtgcacccggttattatggcaacccttggcaggctaggggtcgatgccagccc
tgtgcttgtaataacaacattgatgtgggcgacccaacctcttgtgatcgacggacgggc
cagtgcctccgatgcctctacaactctgagggggaccagtgtcagttctgccaagggggc
tattatggggatgccacacgacgcacctgccgccgatgctcctgtaacttcctgggcaca
gcgcgcagtgagtgtccatcacgagaccaatgtcaatgtgagcggtacagtggacagtgt
cggtgcctgcccaatgtccaaggacaaaactgtgaccattgtgcccccaacttctggaac
atagccagtggacagggctgccagccgtgtgattgccaccctcagtactcactcagctct
gcttgcaatcagtttacagggcagtgccaatgtcgaccaggttttggaggccaaacctgt
tcagaatgccaggagaaccactggggtgaaccaaatcagcagtgcagagtctgcgactgt
gaccctcgtgggatcgagaagccacaatgccaccgcatcaccgggcattgttcctgccgc
ccaggcgtgtcaggcgtgcgctgcgaccagtgttcccgtggctttgctggtgaattccct
gcctgccagccatgtcacaagtgctttggagactgggatcgcatcgtgcaggacctggct
ggccgcacccgtgccctggtacagcgggcccaacagcttcagcagacaggcgtcaccggc
gcttttgagggtcctttccggcgactgcaggagaagctgagcgctgcccagactatagtt
aatgcccgcaatgccactgctagtgccatcacccacctcttgcaaaacatggatgagctg
aggcaggagatagctgatataacagaaacactgacccgtctagaagggtttctcacagcc
actcaagacaagaacttcaatgccaaccatgcgctgggcacactggaacgtggcgctcgg
gggctcaacctcagcctggcagatctgtcgcgtcagcttgaggcccttatgaatgccaat
gtcttgggtgcctacgatagtgtccgtcaatcctatgcgcagtcgcgagaagccgagcac
cgggccaatacttccaccttggcagtgcccagccccgtcagccagtcggctgctacccgg
cgtcgcacagaacacctgataacaacgcggagagacgctttcaaccggcagaatgcggcc
aaccggcgaggcctgacagacctgtcgacccgtgtggcagggttgagcctgcaccagatc
aatgagaaggtatgtggggccccaggggatgtcccctgcgccaacagcccctgtggggga
gccggctgccgagatgaagatggccagcgtcactgtgggggactcaactgtaatggggct
gtggccacagctgataatgccctggaccgggcccgccatgcagagggggagctacgccgt
gccgtggtcgatgtggataccctgctgcgtcaggtggctgaagcaaaggcccgggcagga
gaggcaaaacagagagcacaggcggctttggagaatgccaatgccaccaaagcccggctg
gagcgctctaataaagacctgagagatctcatccaacaaatcaaaggattcctgaatctt
gagggggcagatcctgacagcattgctctggtagcttcccgtgtgctggaactctccatc
ccagcatctcctgctcaaatccaccatcttgctgagcagatcaaggagcgtgtcagcagc
ttggccaatgtggatgccatcttgaaccaaacggcaggggatgtccgtgtggcaggggac
ctgctaaaggaggcacgccgggccaatgctcgagcagaaggtgtaaagaatgcagctcaa
tcggtgaagaaggccctcgatgatgccaaacgtgcccaaaatgctgccgagaaagccatc
cgtgatgcagccagcgatatccatcacacagaagacatggtgaacaggatgcaggaaaag
acagcaaatgctgaaggccagttggttttcgccatggagcgggtgggtgacctcgaaagg
caggtggacgaactcaagatgaaacgggccaacaacatcctggcagccacgcgagctgaa
gagacagctagtgctgccagggaaagagctggggaagctgaacagatcctagatggcccg
ttaagtgaccagtaccgcacaatgaaggagcttgtggagcacaaagcccagcatgtcctg
ggggctcggcagaaagcggagcgcctgcgcgatgaagccaagggactgctgcgcgatgct
catgacaaattgcgccggctcagtgcactagaagaaacatatgaagaaaatgaaagattg
ctgcaggacaaagcagcccagctggacgggttggaagccaagatgagaagcatcttggga
gacatcaatcagcaaatccaaatctacaacacctgccagtga

DBGET integrated database retrieval system