KEGG   Anolis carolinensis (green anole): 100562902Help
Entry
100562902         CDS       T01608                                 

Definition
retinoic acid receptor beta-like
Orthology
K08528  
retinoic acid receptor beta
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 449 aa AA seqDB search
MFDCMDVLAVSPGQMLDFYTASPSSCMLQEKALKACFSGLAQTEWQHRHSTQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPLKQEFMENYEMTAELDDL
TEKIRKSHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPAKVDELQEPLLEALKIYIRKRR
PNKPHMFPKILMKITDLRSISAKGAERVITLKLEIPGSMPPLIQEMLENSEGHEPLTPSS
TGTMADHSPSISPSSVDNTSHASQSPLVQ
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactgtatggatgtcctagcagtgagccctggtcaaatgctggatttctacact
gcaagtccctcttcctgcatgctccaggagaaggctctcaaagcatgcttcagtggattg
gcacagacagagtggcaacaccggcacagtacgcaatcaattgaaactcagagcaccagt
tctgaggagcttgttcccagcccaccttccccgcttcctccccctcgcgtttacaagccc
tgttttgtttgtcaggacaaatcttctggataccactatggcgtcagtgcttgtgaggga
tgtaagggttttttccgcagaagcattcagaagaacatggtttatacatgtcaccgggat
aagaattgtgttattaataaagtcactaggaatcgctgccagtactgcagactacagaag
tgctttgaagtgggaatgtccaaagaatctgtcagaaatgacaggaacaagaaaaagaag
gagcctttaaaacaggagtttatggagaactatgaaatgacagcagagttggatgatctc
acagagaaaataaggaaatctcatcaggaaacgttcccgtcactctgtcagctgggcaaa
tacactacgaactctagtgcagatcacagagttcgactggaccttgggctttgggacaaa
ttcagtgaacttgcaacaaagtgcattattaaaatagtggaatttgcaaaacggctgcct
ggttttacaagtctgacaattgcagaccagatcactctacttaaagctgcctgtttggac
atcttgatccttagaatttgcacaagatatacccctgaacaagacacaatgacgttttcc
gacggccttacactgaaccgaactcaaatgcataatgctggatttggtcccctgactgat
cttgtgttcacatttgccaatcagctcctgcccttggaaatggatgacacagaaactggc
cttcttagtgccatctgcttaatctgtggagaccgtcaggatcttgaagaaccagcaaaa
gtggatgaactacaggagccactgctagaggcactgaaaatatacatccgaaagagaaga
cccaacaaacctcatatgtttccaaagatcttaatgaaaatcacagatctacgcagtatc
agcgccaaaggtgctgaacgtgttattaccctgaaattggaaatccctggatccatgcca
cctcttatccaggaaatgttggagaactctgaagggcatgagcccctgaccccaagttca
accgggacaatggcagaccacagccccagcatctccccaagctcagtggataataccagt
catgccagtcagtccccactggtgcaataa

DBGET integrated database retrieval system