KEGG   Anolis carolinensis (green anole): 100562945Help
Entry
100562945         CDS       T01608                                 

Definition
glutathione peroxidase 7-like
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100562945
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100562945
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100562945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 211 aa AA seqDB search
MLDPEGSSEPESHPPLVSKVFLVPFAMLLAVGALLFLAFSASQTKEDNFYAFKVVNIRGK
LVSLEKYRGAVSLVVNVASECGYTDNHYKDLQKLQRELGPYHFNVLAFPCNQFGQQEPNT
NKEIESFARKTYGVSFPMFSKIAVTGNGANPAFRYLVESTNEEPTWNFWKYLVDPNGKAV
KAWDSTVTIAEIKPHITELVRNIILKKRDEL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccccgaaggcagctcggagccggagagccaccctcctctcgtctccaaagtt
ttcctggtccctttcgccatgctgctggccgtgggcgccttgcttttcctggccttttcc
gcctctcagaccaaagaggacaatttttacgcctttaaggtggtcaacatcaggggcaag
ctggtctccctggagaaatacagaggcgcggtctctttagttgtcaatgttgcaagtgag
tgtggatatactgacaaccactacaaagaccttcaaaaactgcagagagagcttggccca
taccattttaatgtgctggcattcccttgcaatcagtttggacagcaagaaccaaatact
aataaagaaatagagagttttgctcggaaaacatatggagtctccttccccatgttcagc
aaaattgcagtcacaggcaatggggcaaatccagctttcagatatttagttgaatccact
aatgaagagccaacctggaatttctggaaataccttgtagatccaaatggaaaagctgta
aaggcctgggactctactgtcactattgcagaaataaaacctcacatcactgaacttgtg
agaaacatcatcctgaagaaaagagatgaactttga

DBGET integrated database retrieval system