KEGG   Anolis carolinensis (green anole): 100562970Help
Entry
100562970         CDS       T01608                                 

Gene name
map2k5
Definition
mitogen-activated protein kinase kinase 5
Orthology
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Gap junction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:acs04010]
Cellular Processes; Cell communication; Gap junction [PATH:acs04540]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 441 aa AA seqDB search
MVKRVHVRAEDATASKLLQSTVIDNIEDVISQVLPDATTTAFEYEDEDGDRITVRSDEEM
KAMLSYYYTTVMEQQVNGQLIVPLQIYPRACKPPGKRNIHGLKVNTRAGSANNSGVAVPD
SLPSNSLKKSSAELKKILANGQMNEQDIRYRDILGHGNGGTVYKANHAPSGKILAVKVIP
LDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISLCTEFMDGGSLDVYRKIPEH
VLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVG
TNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQKNQGSLMPLQLLQCIVDE
KSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHLFIVQYDDGNAEVVSMWVCRML
EERRSQQQQQQQPLQPQEGPL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagagagttcatgtacgggctgaagacgccacagcatctaagttgcttcaatcc
actgtaatcgataatattgaggacgtgatcagtcaagttctccccgatgcaacgactaca
gcgtttgaatatgaagatgaggacggcgatcggatcacggttcgaagtgatgaagaaatg
aaagcgatgctctcctattattatacaacagtaatggagcagcaagtcaatggacagttg
atagtgcctctgcagatctacccaagagcctgcaagcctcctgggaaacggaacatacat
ggcctgaaggtaaatacgcgagccgggtctgctaacaatagcggtgtggccgtcccagac
tccctcccgagcaatagtttgaagaagtcatctgcagaactgaagaagatattagctaac
gggcagatgaatgaacaagacatacgatatcgggacatcctcggtcacggcaacggaggg
accgtctacaaagcaaatcatgcccccagtgggaaaatactggctgtgaaggtgatcccc
ttagatattacgctggagcttcagaagcagattatgtcggagctggaaatcctttacaag
tgtgactcgtcctatatcatagggttttacggtgccttttttgtagaaaaccggatctcc
ctttgtacagaattcatggacgggggatctttggatgtctacagaaaaattccggaacat
gtcttgggcagaatcgctgtcgcagttgttaaaggccttacctacttatggagcttaaag
attttacatcgagacgtgaagccttccaacatgctggtgaacaccagaggccaagtcaag
ttgtgtgattttggggtgagcacccagctggtgaattccatcgccaagacgtatgtcggg
acaaacgcgtacatggcgccagaacgaatttcaggagagcagtatggcattcattccgat
gtttggagtctaggaatttcctttatggagcttgctctcgggaggttcccgtatcctcag
attcagaaaaaccagggatctttaatgcctcttcagttactccagtgcattgttgatgag
aaatcgccggtccttccagttggggagttctccgagccgtttgtacacttcatcactcaa
tgtatgcggaagcagcccaaagaacggccggccccagaagagttaatgggccacctcttc
atcgtccagtatgatgacggcaacgcagaggtggtttccatgtgggtttgccggatgctg
gaagagaggcgctcgcagcagcagcagcagcagcaacccctgcaaccacaggaagggcct
ctctga

DBGET integrated database retrieval system