KEGG   Anolis carolinensis (green anole): 100562970Help
Entry
100562970         CDS       T01608                                 

Gene name
map2k5
Definition
(RefSeq) mitogen-activated protein kinase kinase 5
  KO
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Gap junction
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100562970 (map2k5)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100562970 (map2k5)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100562970 (map2k5)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100562970 (map2k5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 382 aa AA seqDB search
MKAMLSYYYTTVMEQQVNGQLIVPLQIYPRACKPPGKRNIHGLKVNTRAGSANNSGVAVP
DSLPSNSLKKSSAELKKILANGQMNEQDIRYRDILGHGNGGTVYKANHAPSGKILAVKVI
PLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISLCTEFMDGGSLDVYRKIPE
HVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYV
GTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQKNQGSLMPLQLLQCIVD
EKSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHLFIVQYDDGNAEVVSMWVCRM
LEERRSQQQQQQQPLQPQEGPL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatgctctcctattattatacaacagtaatggagcagcaagtcaatggacag
ttgatagtgcctctgcagatctacccaagagcctgcaagcctcctgggaaacggaacata
catggcctgaaggtaaatacgcgagccgggtctgctaacaatagcggtgtggccgtccca
gactccctcccgagcaatagtttgaagaagtcatctgcagaactgaagaagatattagct
aacgggcagatgaatgaacaagacatacgatatcgggacatcctcggtcacggcaacgga
gggaccgtctacaaagcaaatcatgcccccagtgggaaaatactggctgtgaaggtgatc
cccttagatattacgctggagcttcagaagcagattatgtcggagctggaaatcctttac
aagtgtgactcgtcctatatcatagggttttacggtgccttttttgtagaaaaccggatc
tccctttgtacagaattcatggacgggggatctttggatgtctacagaaaaattccggaa
catgtcttgggcagaatcgctgtcgcagttgttaaaggccttacctacttatggagctta
aagattttacatcgagacgtgaagccttccaacatgctggtgaacaccagaggccaagtc
aagttgtgtgattttggggtgagcacccagctggtgaattccatcgccaagacgtatgtc
gggacaaacgcgtacatggcgccagaacgaatttcaggagagcagtatggcattcattcc
gatgtttggagtctaggaatttcctttatggagcttgctctcgggaggttcccgtatcct
cagattcagaaaaaccagggatctttaatgcctcttcagttactccagtgcattgttgat
gagaaatcgccggtccttccagttggggagttctccgagccgtttgtacacttcatcact
caatgtatgcggaagcagcccaaagaacggccggccccagaagagttaatgggccacctc
ttcatcgtccagtatgatgacggcaacgcagaggtggtttccatgtgggtttgccggatg
ctggaagagaggcgctcgcagcagcagcagcagcagcaacccctgcaaccacaggaaggg
cctctctga

DBGET integrated database retrieval system