KEGG   Anolis carolinensis (green anole): 100563048Help
Entry
100563048         CDS       T01608                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100563048
  Lipid metabolism
   00062 Fatty acid elongation
    100563048
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100563048
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100563048
Lipid biosynthesis proteins [BR:acs01004]
 Fatty acid synthase
  Component type
   100563048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 296 aa AA seqDB search
MASIRLFVSFVLLSGAFCRMEPVPLVIWHGMGDSCCNPESMGYIKKIVEKKIPGIYVLSL
KIGSTLIEDMENSFFKNVNDQVTLVCDMLAKDPKLKGGYNAMGFSQGGQFLRAVVQRCPT
PPIINLISVGGQHQGVYGFPRCPGESSHICDWIRKMLDLGAYTKEVQDRLVQAQYWHDPL
NEEEYRKKSLFLADINQERFVNTTYKKNLMSLNKFVMVKFLNDTMVDPPASEWFGYYRSN
QATETIPLNETLLYTEDRLGLMEMDQAGKLVFLGVEGDHLHFSKDWFYKNILPFLQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgatcaggctgtttgtgtcttttgtgctgctctcaggagccttttgccggatg
gagccggtgcctctggtgatttggcacggcatgggtgatagctgttgcaatcccgaaagc
atgggttacattaaaaaaatagtggagaagaaaatcccagggatttatgttctttctctg
aagattggcagtactttgattgaggacatggagaacagcttctttaagaatgtcaatgac
caggtgacacttgtgtgtgatatgctcgcaaaagaccccaaactgaaaggcggctacaat
gccatgggcttctcccagggaggacaattcctgcgggccgtggtacagagatgtccaact
cccccaataatcaatctgatttctgtgggaggtcagcatcaaggtgtgtatgggtttcca
cgctgtcctggtgagagttcacacatctgtgattggatccgaaagatgcttgatcttggg
gcctacaccaaggaggtccaggaccgtctagtacaagctcagtattggcatgatccactg
aatgaagaggaatacagaaagaagagccttttcttggctgacatcaatcaggagcgattt
gtcaacacaacctacaagaaaaacctgatgtctttgaacaagtttgtgatggtgaagttc
ctgaatgacactatggttgaccctcctgcctcagagtggtttgggtactatcggagcaac
caggctacagaaaccatccccctgaatgagacattactctacacagaggatcgcttgggc
ctgatggaaatggaccaggcaggaaagctggtgttcctgggagtggaaggcgaccacctt
cacttttcgaaagattggttctacaaaaacattctgccatttctacagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system