KEGG   Anolis carolinensis (green anole): 100563069Help
Entry
100563069         CDS       T01608                                 

Gene name
lamb1
Definition
laminin subunit beta-2
Organism
acs  Anolis carolinensis (green anole)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1859 aa AA seqDB search
MVIILTCLFVCLLLLVSFGRIHPKARCLKISWNEVGLFFLLLFQPVQVADAQGPEEPDLL
YHGCLEGSCYPATGNLLIGRAQSLSATSTCGLEGPQDYCIVSHLQDSEKCFLCDSHSASL
RENHHIENVIYLSGQDGEQTWWQSENGVEEVSIRLDLEAEFHFTHLIMKFKTFRPAAMLI
ERSSDFGRSWKVYRYFAFNCSKLFPGIPTQIPAHVNQAVCDQRYSEIEPSSHGEVIFKVL
DPAIKVEDPYSQEIQDLLRVTNLRVNFTKLHTLGDNLLDSRLQVLQKYYYAVYELVLRGS
CFCYGHASECAPLAGVTNLVEGMIHGRCVCKHHTKGLNCELCKDFYQELPWRPAEAHDSH
ACKECNCNEHSHRCHFDMAVYLATGNTSGGVCDECLHNTMGRHCQLCKPFYYRNPMADIR
ASTACIPCDCDPVGSLDGGVCDSHTDVSLGMIAGQCRCKDNVKGVRCDSCKEAFYGLSQN
DPLGCQPCRCDPRGIIAGNSPCDHISGDCYCKRFVTGRYCNQCLPEYWGLSYDMTGCRGC
ACDFGGAYSNRCSMDDGQCPCRPHFMGRQCDDVQPGFFCMPLDYYMYEAEHATGLPPTHQ
SLPGALRPEAPVDCVEYYNGVQNGRKVRLRRQHSTIRVLQQRGALRRARQLQQKPDVEVI
QREHTGHMITWTGPGFARVRDGAGLSFHISNIPYPMDYDILLRYEPESTEDWEAVVSVSS
QALPMSPRCGNVLPSEQMYRESLPHSSRYVLLPRPFCFEPRNHYEITVRFQRTGVAQRHP
AAFLLVDSLVLLPRVTELPGLHGNDPASVERREALERYTCLEAFRMATMPDLAETCAQLL
CSISALMHDGALPCQCDPQGSTSSVCHKLGGQCQCKPNVIGRRCDECVPGTYGFGPYGCI
PCACSHEGSASKICEPTSGQCRCQHGTVGRQCDQCPPGHWGFPSCRPCHCNGHSEECDLH
TGACHDCRDYTAGRHCERCLDGYYGDPILGSGQQCRPCPCPGYPGSRHYHGISCDTDRET
NQISCLCAPGYTGLRCDRCSPGYFGAPEQEGGACRPCQCNNNIDTSDPEACDPHTGQCLR
CLYYTSGPHCAECQPGYYGSAFQRSCRRCTCNEQGTLPMHCSKGICHCDRTTGNCPCRAN
VVDKNCDRCAQNFWGFGSDLGCQPCDCDPAHSLRSDCNMFTGQCHCQPGFGGRVCSQCQE
DHWGDPEQECLPCECDPAGSESPQCDRLSGHCLCREGFTGRRCHQCQRGFHKNFPRCSPC
HPCFGQWDKVLGQLWEQVQRLQDAVKALKEGGPIPEASSNRMRNLENSLDHVEQLLGDGS
SPNAPLLHEISTVLADIRADMDELWQQLQTTNSHLDETDQTDTGQRSHLNKLNRELRELN
HTVNHLRKMSNGSFNESFHSILESFQQSELAQQRANASVQGPQSPVGQAKHTRRVTVELL
RRRGDAFRQSAAVHRKSLQNIQEQIDSLGLSTINEKICGASGEEECEPCGGASCRDSLGQ
RHCGGPGCTGALPVSAKALDTAQNISLQLETTLKQLGTISSKVQEIQELAQDARNHAQET
LGQAQGARSRVEKSTAKLREFIQKIKDFLAEEGADPESIELVAQQVLNISLPGSPGQISS
LIKEIHDRIGELDGVDIILNNTVHNLTRARELLAEAEEAKERAEGVEAIIAETRAELSGV
REQVSAAERAMKSAKEAIRSVEGRIRQAERQLQTLVSKESQVESRLGDLAQDVADLQKKS
QANQQLAQEAKGKAEHATAAAGRLENDVEKVMQGYQKLQDKLGELPQDVLFKLKNLRDEA
QNLLNKANDSKRKLEELEERFQTNEKEMKDKANTLQSLEKQVTDLLEFIRNKATAYATC
NT seq 5580 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcatattaacatgtttgtttgtttgtttgttacttttggtttcttttggaaga
atccatcctaaggccaggtgcctcaaaatatcttggaatgaggttgggctatttttcctt
cttctttttcaaccagtccaggtagctgatgctcaaggtcccgaagagcctgacctgttg
tatcatggctgtttagaggggagctgctacccggccaccggaaatcttctcatcgggagg
gctcagagcttgagcgccacctcaacatgcggcttggaaggccctcaggactactgcatt
gtcagccatctacaggactctgagaaatgcttcctgtgcgactctcactcggcctccctg
cgcgaaaaccaccacattgagaatgtcatctacctgagtggccaggatggggagcagacc
tggtggcagtcggagaatggtgttgaagaggtcagcatccgcttggacttggaagccgag
ttccattttactcacctcataatgaagtttaagaccttccgcccagctgccatgttgatt
gagcggtcatccgattttgggcgcagctggaaagtgtatcgctactttgccttcaactgc
tccaaactcttccctggcatccccactcagattccagcacacgtcaaccaggcagtctgt
gaccagcgatactcagagattgagccctccagccacggtgaggtaattttcaaagtgctg
gacccagctataaaagtagaggatccctacagccaggaaatccaagatttgttacgtgtc
accaatttgcgagtgaacttcacaaagctgcatactctgggggacaacctcctggactcg
cgacttcaggtgcttcagaaatactactacgctgtgtatgagctggtgctgcgtggaagc
tgcttctgctatggacatgcctcagagtgcgctcctttggctggagtgacaaacctagtt
gaaggcatgatccatggccgatgcgtctgcaagcaccacacaaaaggcctcaactgtgaa
ctctgcaaggacttttaccaggagttgccttggaggccagctgaggcccacgattcacac
gcctgcaaagagtgcaactgcaatgagcactcacataggtgccactttgacatggccgtg
tacctggccacgggcaacaccagcggcggggtctgtgatgagtgcctgcacaacaccatg
gggcgccactgccagctctgcaagcccttctactatcgcaacccaatggctgacatccgc
gcaagcactgcctgcatcccctgtgactgtgatcccgtgggctcgttggatggtggcgtg
tgcgacagtcatacagatgtgtccttgggcatgatcgcagggcagtgccgctgcaaagac
aatgtcaaaggcgtgcgttgtgacagctgcaaagaagccttctatggactgagccagaac
gatcctctgggttgccagccctgcaggtgtgacccgcgtgggatcattgcaggaaacagc
ccttgtgaccatatcagtggtgactgctattgcaagcgttttgtcacagggcgatattgc
aaccagtgtctgccagaatattggggcctgagctatgacatgactggctgccggggctgc
gcttgtgactttggaggggcttacagcaacagatgctctatggatgatggccagtgcccc
tgtcggcctcacttcatggggcgtcagtgtgatgatgtacaacctgggttcttctgcatg
ccgttggactactacatgtatgaagccgaacatgccacaggtctcccaccaacccatcag
agcctaccgggtgctttgcgtcctgaggccccagtggactgtgtggagtattataatgga
gtccaaaatgggcggaaagtgcggctgcggcgccagcatagcaccataagagtcttacag
cagcgaggagcccttcggcgagcccggcaacttcagcaaaagcctgatgtagaagtcata
cagcgtgaacatacaggccacatgattacgtggacgggaccaggctttgctcgtgttcgt
gatggggctggtttatctttccatattagcaacattccctaccccatggactatgacatc
cttctacgctatgagccagagtctacagaagattgggaagctgtggtcagcgtcagctcg
caggctttacccatgagtccccgctgtggcaatgtgctaccttcagagcagatgtaccga
gagagcctgccacacagttccaggtatgttctcctgccacgacctttctgttttgagccc
aggaaccattatgagatcacggtgcggttccagcggacaggtgtggcacagcgccatccc
gcagccttcctccttgttgactcgctggtccttttgccgcgtgtgacggagctgccgggg
ctccatggcaatgatcctgcttctgtggagcgtcgtgaggccctggagcgctacacctgc
ctggaggccttccgcatggccactatgcctgacctggccgagacctgcgcccagctcctg
tgcagcatctctgccctgatgcacgatggggctctgccttgccagtgtgacccccaaggc
tccactagcagcgtctgccacaaactaggagggcagtgtcagtgtaagcctaatgtgatc
ggtcggcggtgtgacgagtgtgtcccaggcacctatggatttggaccatatggctgcatt
ccctgtgcctgttcccatgaaggctctgcctccaaaatctgtgaaccaaccagtggacag
tgccggtgccaacatggaaccgtgggacggcagtgtgatcagtgcccaccaggccactgg
ggattcccaagctgccgcccttgccattgcaatgggcactccgaggaatgtgacttgcat
acaggagcctgccacgactgccgggattacaccgctggccgccactgtgagaggtgcctg
gatggctactacggagatccaatcttgggctcaggacaacaatgccggccatgtccttgt
cctggatatcccgggtctcgtcactatcatggcatctcctgtgacacagacagggagacc
aaccagatcagttgcctgtgtgctccaggctatacagggcttcgttgtgaccgttgctca
cctggctattttggagcccctgagcaggaaggtggagcttgccgcccctgtcagtgcaac
aacaacattgacaccagtgaccctgaggcctgtgatccacacactgggcaatgtctgcgc
tgcctctactacaccagcggaccccattgtgccgaatgccaacctggatactatggcagt
gcctttcagcgtagctgtcgacggtgtacctgtaatgaacaaggcaccctgcctatgcac
tgctccaaaggcatctgccactgtgaccgaactacaggcaactgcccttgccgtgccaat
gtggtggacaagaactgtgacagatgtgcccaaaacttctggggctttggcagcgacttg
ggatgtcagccctgtgactgtgatcctgctcattcgttacgttcagactgcaacatgttc
acagggcagtgccactgccagccagggtttggaggacgtgtttgctcccagtgccaagag
gatcattggggagaccccgaacaggaatgtctgccctgtgaatgtgatccagctggatct
gagagtccgcagtgtgaccgcctcagtggacactgtctgtgccgagaaggattcacagga
cggcggtgtcaccagtgccagcggggcttccataagaactttccgcgttgttccccttgc
cacccatgttttgggcaatgggataaagtgctggggcaactctgggaacaggtgcagagg
ctacaggatgctgtcaaagccctgaaagaaggtggccccatacctgaagccagcagcaac
cgtatgcgcaaccttgagaacagtcttgatcatgtggagcagcttcttggggacgggagt
agtccaaatgctcctctccttcatgaaatcagcaccgttctggcagatatcagggcagat
atggatgagctctggcaacagttgcagactactaattcacacctggatgaaaccgatcag
acagacacaggacagaggagccatctcaataaactgaacagagagctaagggagcttaac
cacactgtcaaccacttgaggaagatgtcaaatggcagcttcaatgaatctttccatagc
atcctggagtccttccagcagtcagaactggcccagcagcgagcaaatgcctctgttcaa
ggaccacaaagtccggtgggtcaagccaaacatacgcgtcgcgtcaccgttgaactcttg
agacgccgaggagatgctttccgccagagtgcggctgttcaccgaaagtcactgcagaac
attcaggaacaaattgatagtcttggactgagcacgatcaatgagaaaatctgcggtgct
tccggagaggaggagtgtgaaccctgcggaggagcctcctgccgagacagcttaggccag
cgacattgcggaggccctggctgtactggagctctccctgtgtctgcaaaggcactggac
acggcccagaacatctctcttcagctagagaccacattgaagcagctgggcaccatttct
agcaaggtgcaagaaatccaagagttggcacaggatgccaggaatcatgcccaggagaca
ctgggacaagctcagggagctcggagccgtgtggagaagtcaacagctaagctgagggaa
ttcatccaaaaaattaaggactttctagcagaggaaggggctgaccctgagagcattgag
cttgtggcccagcaagtgctgaacatctccttgcctggcagtccaggtcaaatcagcagc
ctgattaaagaaatccatgacagaattggagagctggatggtgtggacatcatcctgaac
aatacagtgcacaacctgacccgtgccagggaactactggcagaagcagaagaggccaaa
gagcgagcagagggtgtagaggcaataatcgcagaaacccgtgcagaactaagcggtgtg
agggaacaagtgagtgcagcagagcgagctatgaagagtgccaaggaggccattcgcagt
gtggagggccgaatcaggcaggctgagcgccagctccaaacgctggtcagcaaggagtca
caggtggaaagtcgccttggagacctggcacaggatgtggccgatttacaaaagaagtcc
caggctaatcagcagctggcacaggaggccaaggggaaagcagagcatgccacggctgct
gcagggaggctagaaaatgatgtggaaaaagtgatgcagggataccagaagctgcaagac
aaattgggcgaactgccccaggatgtactcttcaaactgaaaaacctgagggacgaagcc
cagaatctcctaaacaaggccaatgacagcaagcgaaagttggaagagctggaagagcgc
tttcagacgaatgagaaagaaatgaaggacaaagcaaacactctgcagtcgctggagaaa
caagtgacagacctgctggagttcatccgtaacaaagccactgcctatgctacctgttag

DBGET integrated database retrieval system