KEGG   Anolis carolinensis (green anole): 100563069Help
Entry
100563069         CDS       T01608                                 

Gene name
lamb1
Definition
laminin, beta 1
Orthology
K06243  
laminin, beta 2
Organism
acs  Anolis carolinensis (green anole)
Pathway
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:acs04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:acs04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1827 aa AA seqDB search
MAVQVADAQGPEEPDLLYHGCLEGSCYPATGNLLIGRAQSLSATSTCGLEGPQDYCIVSH
LQDSEKCFLCDSHSASLRENHHIENVIYLSGQDGEQTWWQSENGVEEVSIRLDLEAEFHF
THLIMKFKTFRPAAMLIERSSDFGRSWKVYRYFAFNCSKLFPGIPTQIPAHVNQAVCDQR
YSEIEPSSHGEVIFKVLDPAIKVEDPYSQEIQDLLRVTNLRVNFTKLHTLGDNLLDSRLQ
VLQKYYYAVYELVLRGSCFCYGHASECAPLAGVTNLVEGMIHGRCVCKHHTKGLNCELCK
DFYQELPWRPAEAHDSHACKECNCNEHSHRCHFDMAVYLATGNTSGGVCDECLHNTMGRH
CQLCKPFYYRNPMADIRASTACIPCDCDPVGSLDGGVCDSHTDVSLGMIAGQCRCKDNVK
GVRCDSCKEAFYGLSQNDPLGCQPCRCDPRGIIAGNSPCDHISGDCYCKRFVTGRYCNQC
LPEYWGLSYDMTGCRGCACDFGGAYSNRCSMDDGQCPCRPHFMGRQCDDVQPGFFCMPLD
YYMYEAEHATGLPPTHQSLPGALRPEAPVDCVEYYNGVQNGRKVRLRRQHSTIRVLQQRG
ALRRARQLQQKPDVEVIQREHTGHMITWTGPGFARVRDGAGLSFHISNIPYPMDYDILLR
YEPESTEDWEAVVSVSSQALPMSPRCGNVLPSEQMYRESLPHSSRYVLLPRPFCFEPRNH
YEITVRFQRTGVAQRHPAAFLLVDSLVLLPRVTELPGLHGNDPASVERREALERYTCLEA
FRMATMPDLAETCAQLLCSISALMHDGALPCQCDPQGSTSSVCHKLGGQCQCKPNVIGRR
CDECVPGTYGFGPYGCIPCACSHEGSASKICEPTSGQCRCQHGTVGRQCDQCPPGHWGFP
SCRPCHCNGHSEECDLHTGACHDCRDYTAGRHCERCLDGYYGDPILGSGQQCRPCPCPGY
PGSRHYHGISCDTDRETNQISCLCAPGYTGLRCDRCSPGYFGAPEQEGGACRPCQCNNNI
DTSDPEACDPHTGQCLRCLYYTSGPHCAECQPGYYGSAFQRSCRRCTCNEQGTLPMHCSK
GICHCDRTTGNCPCRANVVDKNCDRCAQNFWGFGSDLGCQPCDCDPAHSLRSDCNMFTGQ
CHCQPGFGGRVCSQCQEDHWGDPEQECLPCECDPAGSESPQCDRLSGHCLCREGFTGRRC
HQCQRGFHKNFPRCSPCHPCFGQWDKVLGQLWEQVQRLQDAVKALKEGGPIPEASSNRMR
NLENSLDHVEQLLGDGSSPNAPLLHEISTVLADIRADMDELWQQLQTTNSHLDETDQTDT
GQRSHLNKLNRELRELNHTVNHLRKMSNGSFNESFHSILESFQQSELAQQRANASVQGPQ
SPVGQAKHTRRVTVELLRRRGDAFRQSAAVHRKSLQNIQEQIDSLGLSTINEKICGASGE
EECEPCGGASCRDSLGQRHCGGPGCTGALPVSAKALDTAQNISLQLETTLKQLGTISSKV
QEIQELAQDARNHAQETLGQAQGARSRVEKSTAKLREFIQKIKDFLAEEGADPESIELVA
QQVLNISLPGSPGQISSLIKEIHDRIGELDGVDIILNNTVHNLTRARELLAEAEEAKCHH
IFSSFMSRERAEGVEAIIAETRAELSGVREQVSAAERAMKSAKEAIRSVEGRIRQAERQL
QTLVSKESQVESRLGDLAQDVADLQKKSQANQQLAQEAKGKAEHATAAAGRLENDVEKVM
QGYQKLQDKLGELPQDVLFKLKNLRDEAQNLLNKANDSKRKLEELEERFQTNEKEMKDKA
NTLQSLEKQVTDLLEFIRNKATAYATC
NT seq 5484 nt NT seq  +upstreamnt  +downstreamnt
atggcggtccaggtagctgatgctcaaggtcccgaagagcctgacctgttgtatcatggc
tgtttagaggggagctgctacccggccaccggaaatcttctcatcgggagggctcagagc
ttgagcgccacctcaacatgcggcttggaaggccctcaggactactgcattgtcagccat
ctacaggactctgagaaatgcttcctgtgcgactctcactcggcctccctgcgcgaaaac
caccacattgagaatgtcatctacctgagtggccaggatggggagcagacctggtggcag
tcggagaatggtgttgaagaggtcagcatccgcttggacttggaagccgagttccatttt
actcacctcataatgaagtttaagaccttccgcccagctgccatgttgattgagcggtca
tccgattttgggcgcagctggaaagtgtatcgctactttgccttcaactgctccaaactc
ttccctggcatccccactcagattccagcacacgtcaaccaggcagtctgtgaccagcga
tactcagagattgagccctccagccacggtgaggtaattttcaaagtgctggacccagct
ataaaagtagaggatccctacagccaggaaatccaagatttgttacgtgtcaccaatttg
cgagtgaacttcacaaagctgcatactctgggggacaacctcctggactcgcgacttcag
gtgcttcagaaatactactacgctgtgtatgagctggtgctgcgtggaagctgcttctgc
tatggacatgcctcagagtgcgctcctttggctggagtgacaaacctagttgaaggcatg
atccatggccgatgcgtctgcaagcaccacacaaaaggcctcaactgtgaactctgcaag
gacttttaccaggagttgccttggaggccagctgaggcccacgattcacacgcctgcaaa
gagtgcaactgcaatgagcactcacataggtgccactttgacatggccgtgtacctggcc
acgggcaacaccagcggcggggtctgtgatgagtgcctgcacaacaccatggggcgccac
tgccagctctgcaagcccttctactatcgcaacccaatggctgacatccgcgcaagcact
gcctgcatcccctgtgactgtgatcccgtgggctcgttggatggtggcgtgtgcgacagt
catacagatgtgtccttgggcatgatcgcagggcagtgccgctgcaaagacaatgtcaaa
ggcgtgcgttgtgacagctgcaaagaagccttctatggactgagccagaacgatcctctg
ggttgccagccctgcaggtgtgacccgcgtgggatcattgcaggaaacagcccttgtgac
catatcagtggtgactgctattgcaagcgttttgtcacagggcgatattgcaaccagtgt
ctgccagaatattggggcctgagctatgacatgactggctgccggggctgcgcttgtgac
tttggaggggcttacagcaacagatgctctatggatgatggccagtgcccctgtcggcct
cacttcatggggcgtcagtgtgatgatgtacaacctgggttcttctgcatgccgttggac
tactacatgtatgaagccgaacatgccacaggtctcccaccaacccatcagagcctaccg
ggtgctttgcgtcctgaggccccagtggactgtgtggagtattataatggagtccaaaat
gggcggaaagtgcggctgcggcgccagcatagcaccataagagtcttacagcagcgagga
gcccttcggcgagcccggcaacttcagcaaaagcctgatgtagaagtcatacagcgtgaa
catacaggccacatgattacgtggacgggaccaggctttgctcgtgttcgtgatggggct
ggtttatctttccatattagcaacattccctaccccatggactatgacatccttctacgc
tatgagccagagtctacagaagattgggaagctgtggtcagcgtcagctcgcaggcttta
cccatgagtccccgctgtggcaatgtgctaccttcagagcagatgtaccgagagagcctg
ccacacagttccaggtatgttctcctgccacgacctttctgttttgagcccaggaaccat
tatgagatcacggtgcggttccagcggacaggtgtggcacagcgccatcccgcagccttc
ctccttgttgactcgctggtccttttgccgcgtgtgacggagctgccggggctccatggc
aatgatcctgcttctgtggagcgtcgtgaggccctggagcgctacacctgcctggaggcc
ttccgcatggccactatgcctgacctggccgagacctgcgcccagctcctgtgcagcatc
tctgccctgatgcacgatggggctctgccttgccagtgtgacccccaaggctccactagc
agcgtctgccacaaactaggagggcagtgtcagtgtaagcctaatgtgatcggtcggcgg
tgtgacgagtgtgtcccaggcacctatggatttggaccatatggctgcattccctgtgcc
tgttcccatgaaggctctgcctccaaaatctgtgaaccaaccagtggacagtgccggtgc
caacatggaaccgtgggacggcagtgtgatcagtgcccaccaggccactggggattccca
agctgccgcccttgccattgcaatgggcactccgaggaatgtgacttgcatacaggagcc
tgccacgactgccgggattacaccgctggccgccactgtgagaggtgcctggatggctac
tacggagatccaatcttgggctcaggacaacaatgccggccatgtccttgtcctggatat
cccgggtctcgtcactatcatggcatctcctgtgacacagacagggagaccaaccagatc
agttgcctgtgtgctccaggctatacagggcttcgttgtgaccgttgctcacctggctat
tttggagcccctgagcaggaaggtggagcttgccgcccctgtcagtgcaacaacaacatt
gacaccagtgaccctgaggcctgtgatccacacactgggcaatgtctgcgctgcctctac
tacaccagcggaccccattgtgccgaatgccaacctggatactatggcagtgcctttcag
cgtagctgtcgacggtgtacctgtaatgaacaaggcaccctgcctatgcactgctccaaa
ggcatctgccactgtgaccgaactacaggcaactgcccttgccgtgccaatgtggtggac
aagaactgtgacagatgtgcccaaaacttctggggctttggcagcgacttgggatgtcag
ccctgtgactgtgatcctgctcattcgttacgttcagactgcaacatgttcacagggcag
tgccactgccagccagggtttggaggacgtgtttgctcccagtgccaagaggatcattgg
ggagaccccgaacaggaatgtctgccctgtgaatgtgatccagctggatctgagagtccg
cagtgtgaccgcctcagtggacactgtctgtgccgagaaggattcacaggacggcggtgt
caccagtgccagcggggcttccataagaactttccgcgttgttccccttgccacccatgt
tttgggcaatgggataaagtgctggggcaactctgggaacaggtgcagaggctacaggat
gctgtcaaagccctgaaagaaggtggccccatacctgaagccagcagcaaccgtatgcgc
aaccttgagaacagtcttgatcatgtggagcagcttcttggggacgggagtagtccaaat
gctcctctccttcatgaaatcagcaccgttctggcagatatcagggcagatatggatgag
ctctggcaacagttgcagactactaattcacacctggatgaaaccgatcagacagacaca
ggacagaggagccatctcaataaactgaacagagagctaagggagcttaaccacactgtc
aaccacttgaggaagatgtcaaatggcagcttcaatgaatctttccatagcatcctggag
tccttccagcagtcagaactggcccagcagcgagcaaatgcctctgttcaaggaccacaa
agtccggtgggtcaagccaaacatacgcgtcgcgtcaccgttgaactcttgagacgccga
ggagatgctttccgccagagtgcggctgttcaccgaaagtcactgcagaacattcaggaa
caaattgatagtcttggactgagcacgatcaatgagaaaatctgcggtgcttccggagag
gaggagtgtgaaccctgcggaggagcctcctgccgagacagcttaggccagcgacattgc
ggaggccctggctgtactggagctctccctgtgtctgcaaaggcactggacacggcccag
aacatctctcttcagctagagaccacattgaagcagctgggcaccatttctagcaaggtg
caagaaatccaagagttggcacaggatgccaggaatcatgcccaggagacactgggacaa
gctcagggagctcggagccgtgtggagaagtcaacagctaagctgagggaattcatccaa
aaaattaaggactttctagcagaggaaggggctgaccctgagagcattgagcttgtggcc
cagcaagtgctgaacatctccttgcctggcagtccaggtcaaatcagcagcctgattaaa
gaaatccatgacagaattggagagctggatggtgtggacatcatcctgaacaatacagtg
cacaacctgacccgtgccagggaactactggcagaagcagaagaggccaagtgccatcat
attttttcttccttcatgtccagagagcgagcagagggtgtagaggcaataatcgcagaa
acccgtgcagaactaagcggtgtgagggaacaagtgagtgcagcagagcgagctatgaag
agtgccaaggaggccattcgcagtgtggagggccgaatcaggcaggctgagcgccagctc
caaacgctggtcagcaaggagtcacaggtggaaagtcgccttggagacctggcacaggat
gtggccgatttacaaaagaagtcccaggctaatcagcagctggcacaggaggccaagggg
aaagcagagcatgccacggctgctgcagggaggctagaaaatgatgtggaaaaagtgatg
cagggataccagaagctgcaagacaaattgggcgaactgccccaggatgtactcttcaaa
ctgaaaaacctgagggacgaagcccagaatctcctaaacaaggccaatgacagcaagcga
aagttggaagagctggaagagcgctttcagacgaatgagaaagaaatgaaggacaaagca
aacactctgcagtcgctggagaaacaagtgacagacctgctggagttcatccgtaacaaa
gccactgcctatgctacctgttag

DBGET integrated database retrieval system