KEGG   Anolis carolinensis (green anole): 100563129Help
Entry
100563129         CDS       T01608                                 

Gene name
g6pc2
Definition
glucose-6-phosphatase, catalytic, 2
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100563129 (g6pc2)
   00052 Galactose metabolism
    100563129 (g6pc2)
   00500 Starch and sucrose metabolism
    100563129 (g6pc2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100563129 (g6pc2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100563129 (g6pc2)
   04920 Adipocytokine signaling pathway
    100563129 (g6pc2)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100563129 (g6pc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 352 aa AA seqDB search
MDLLHSNGVLIIQHLQKDYRSYQSFLNFMSHVGDPRNIFSIYFPLWFQLNRVVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWVQETMIYPNQTSPCLEQFPITCETGPGSPSGHAMXVW
YIMVSAALSYTVRLKDETAINLYRLTWSFLWSMFWIIQISVCVSRVFIATHFPHQVILGV
IAGMLVAEAFEYAPAIQTASLKTYIQTNVFLFASALGLYLVLKLIDIDLLWSVPKAKKWC
ANPEWINIDTTPFAGLVRNLGALFGLGLGINSDMFIISCNGKHGYKPSFRILCIATSLAT
LQLYDFIKIPTHTEYLFYILSFCKSAAIPLTVVALIPYCIHLLMKPIEKKLP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggatctcctccatagcaatggagtgctcataattcagcatttgcagaaggattacagg
tcttatcagagctttctcaatttcatgtcacatgttggagatcctcggaatattttctca
atttattttcctctctggttccagcttaaccgagtggttgggacaaaaatgatctgggtg
gcagtgattggtgattggttcaatcttatatttaaatggattctatttggtcatcggccg
tattggtgggtccaagaaactatgatctatcctaaccaaactagcccatgtcttgagcaa
tttcccataacatgtgaaacaggaccaggaagcccctctggtcatgccatgngtgtttgg
tacataatggtgtcagcagcccttagctatacagtgagactgaaagatgagacagctatc
aacctttacagactcacctggtctttcttgtggagcatgttctggattatacagatcagt
gtgtgtgtgtcaagagtattcatagcgacacattttccccatcaagttatccttggagta
attgctggtatgctagttgcagaagcatttgaatatgctccagccattcagacagcaagc
ttaaaaacatacatccagaccaatgtgtttctctttgcttctgctcttggcttgtatctg
gttctcaagttgattgacattgaccttctgtggtctgtaccgaaggcaaagaaatggtgt
gccaacccagagtggatcaatattgacacaactccctttgctggattggtgagaaacttg
ggtgctctctttgggctcggactcggcattaattctgacatgtttatcataagctgtaat
ggtaaacatggctataagcccagtttcaggatactgtgcatagccacatctttggctacc
ctgcagctctatgattttatcaaaatacctacccacactgagtatttgttttacatcctt
tctttctgcaaaagtgctgccataccgcttacagtagtggctttgattccatactgcata
catttgctaatgaagccaatagaaaagaagcttccataa

DBGET integrated database retrieval system