KEGG   Anolis carolinensis (green anole): 100563205Help
Entry
100563205         CDS       T01608                                 

Gene name
si, mgam
Definition
sucrase-isomaltase (alpha-glucosidase)
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100563205 (si)
   00500 Starch and sucrose metabolism
    100563205 (si)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100563205 (si)
    3.2.1.20  alpha-glucosidase
     100563205 (si)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 2705 aa AA seqDB search
MGKKKFSGLEVTLITLFILVVIVACALIGLLATGHSGLKDFSPTCPAVEFSDRIDCIPDQ
VATKSLCTLRGCCWNPQNETFIPWCYFSNSHGYKADGGQKQTNTGFEVKLKRLPAPSLFG
ADVGEILLTAEYQTANRFRFKITDPAYNRYEVPHTNVKPFVGPKASNPNYRVEITESPFS
IQVIRNTNNKVLFDTSIGPLVYADQFLQLSIRLPSENVYGIGEHVHKQYRHDFNWKTWSI
FTRDALPLGAMDNLYGAQPFFLCLEDASGHSFGVFLMNSNAMDFALQPAPAVTYRTIGGI
LDFYIFLGNTPEQVVQEYLTLIGLPWMPSYWNLGFQICRWDYADLDDVKAAVERNRAAGI
PFDVQYTDIDYMEDTKDFTYDKIKFAGLPEFAQDLHDHGQKYIIILDPAISIHDLRNNTP
YETYRRGNEMKVWVNESDGIKPLIGEVWPGICVYPDFSNPDTVTWWSNECDTFHKTIPFD
GLWIDMNEVSNFVKGSTSGCAQNNLNYPPFTPKILDGVMYSKTLCMDAVQKAGKHYDVHS
LYGFFMTTATDQALQTVFPGKRSLLLSRSTFAGSGKFSGHWLGDNDATWNNMKWAIPGMM
EFNLFGYPYIGADICGFLLNATEELCRRWLQVGAFYPFSRNHNGENNDHNDPASFGKDSL
LVNSTKHYLNIRYTLLPYLYTLFYKAHAHGETVVRPVLHEFYSDEATWAIDRQFLWGPGL
LITPVLDEGANTVDAYMPDAVWYEYETGRKAIWRKQQCQMYLPADKLGLHLRGGYIFPTQ
QPANTTVFSRVNPMGLIIALNDNGTATGELFWDDGETRGTVENKAYLLYQFSVSNDVLTM
SVAHNGYQDPKNLEFQEVKIFGLSLELTEVKVTSNNVAQNYPVNVNYIAADKVAHITGLQ
LKLGEPHTVSWNQVSKDSDKFDCYPYQDATQANCQALGCIWEASPTPGVPYCYFHNNAGY
TVDKVQYTSSGFTADLSTSQRSFRSAKLAITPINTLRLEVKYHENHMLQFKIFDYSNKRY
EVPVPLNLPSTPASTPENRLYDVSVQNNPFGIQIQRRSTGTVIWDSQLPSFIFSDMFIQI
STRLPSQYVYGFGETEHKQYRHEMDWHTWPMFARDQSPGYKFNTYGVQPFYMGLENDGNA
HGVLLLNSNGMEVKLQPTPALTYRTLGGILDFYVVLGPTPEQVVQQYTALIGRPVMPPYW
GLGFQLSRYGYENDGEISNLYNDMKAAKIPYDVQYADIDYMERQMDFTLSPKFSNLPSLV
DRIKEDGMRFVIILDPAISGNETNYPAFTRGVQEDVFIKWPNGSGIVWGKVWPYLPDVVV
DPSLGWDEKVEKYCAWAAFPDFFRESTADWWKREIQEFHTNPTNPEKSIKFDGLWIDMNE
PSNFVNGAVHGCGDSELNFPPYMPGIEGKDAGLCSKTLCMQSQQLLPDGTQLRHYDVHNI
YGWSQTKPTYDALHSVTGQRGIVITRSTYPSSGKWAGHWLGDNFSLWDQLYKSIIGMMEF
SLFGMSYTGADICGFNYDSNYQMCARWTQLGAFYPYSRNHNGIGYLRQDPAAFDEKFQEI
SRNVLNTRYTLLPYLYTLMYEAHAHGNTVVRPLLHEFVDDKVTWEIYEQFLWGPALLISP
ALHPNVTEVNAYFPDARWYNYYTNEVEGIRKEFQNLATPLEHINLHLRGGNIIPWQLPAL
NTQASRKNMMGLTVALDDNGAAQGLLYWDDGTTIDAYEKGLYLLHTFNASQNVLNIGIAH
QRYFDPNNLKFGEIKILGVVSTITPVVIVLQNGAEIPSSHSATYNVSSQVLHITGLQLAV
GQEYTLRWEPKVFQDTDKFNCHPYPEPTQSTCEARGCIWEVVSTPGVPHCFYPSNYGYSV
SNIQTTAVGLTADLHRNTEFPNPYGSRSPAVDLLRLEVTYHYNDMLQFKIYDPNNKRYEV
PVPLFTPNNPESTDADRLYQVEIVNNPFGIQIKRKSTGSVIWNSQVPGFTFSDMFIQIAT
LLPSQYVYGFGENEHTHFRRDMNWETWGMFTKDQPPGYKLNSYGFQPFYMGMENDGSAHG
VLLLNSNAMDVTFQPTPALTYRTIGGILDFYMVLGPNPEEVVQEYTRLIGRPVMPPYWAL
GFQLCRYGYKNTSEVRDLYNEMRAAKIPYDVQYTDINYMERKLDFTLSKDFSDLPDFINE
IKADGSRFIIILDPAISGNETSSYETFTKGLQNKVFVTWPNSTDIAWAKVWPDYPNVTYP
EDSSLEEQLACCRADVAFPDYFRPSTAQWWQEEIENYHASVLQFDGLWTDMNEPSNFIDG
AIGGCRNPDLNYPPYMPALVLRERGLSLVTMCMESEQQLPNGTPVRHYDVHNLYGWSQAE
STYYGMRNATGERGIIITRSTYPSSGRWAGHWLGDNYARWDQLDKSVIGILEFSLFGISY
SGADICGFFNDTTYEMCARWMELGAFYTFSRNHNVLLTRRQDPVAFNSTFEDISRNVLNI
RYRLLPYLYTLMHNAHVDGSTVSRPLLHEFPNDKTTWDIYKQFLWGPALMISPVLDQGEV
TVNAYIPDARWYDYHTGADIKVRKQFKTLEAPLEHINLHIRGGYVIPWQVPNITTNASRQ
NPMGLTIALDDNGVARGQLFWDDGISIDTYENGDYYFSRFQVSENTLNVSVDHNNYLTDT
VDLTIGYLHVWGLTAPVTDVTVTYDGMTETASHQYDLTNQILEVDLTGKNYLIYKLSQVK
WVTTT
NT seq 8118 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaagaaattcagtggattagaagtcactctgatcactctcttcattttggtg
gtgattgtagcttgtgccttgattggacttctagcaacaggtcattctggtctcaaagac
ttttcaccaacatgtccagctgtagaattctctgaccgaatagactgtattccagatcaa
gtggcaacaaagagtctctgcacacttcgtggctgctgctggaatcctcagaatgaaaca
ttcatcccttggtgctacttttctaatagtcatgggtacaaagctgatggaggccaaaaa
cagacaaatacaggatttgaagttaaactaaaaagattgcctgcgccatccctgtttgga
gctgatgttggagaaattctcttaactgcagaatatcagacagcaaaccgctttcggttc
aagattacagatcctgcttataatagatatgaagttccacataccaatgttaaacccttt
gtgggacccaaagcaagcaatccaaactacagggttgaaattactgaaagtcctttcagc
atccaagtgattaggaataccaataataaagttctctttgacaccagcattggaccactt
gtgtatgccgaccagttcttgcaactctccatcagactacccagtgaaaatgtttatgga
attggagaacatgttcacaaacagtataggcatgactttaactggaaaacatggtcaata
tttactcgggatgctctacctcttggagctatggataacctttatggtgctcagcctttc
ttcttgtgtctggaagatgccagtggacactcttttggtgtattcttgatgaacagcaat
gccatggattttgctctccaacctgccccagcggttacatacagaacaattggtggaatt
ctagatttctacatattcttgggaaacactccagaacaggttgtccaagaatatctaacg
ctgataggacttccatggatgccatcatactggaatctgggatttcagatctgtcgctgg
gattatgctgatcttgatgatgtaaaagctgctgtggaaaggaatagggcagctggaata
ccttttgatgttcaatacactgatattgactacatggaagataccaaagattttacctat
gacaaaataaaatttgcaggccttcctgagtttgctcaagaccttcatgaccatggacag
aaatacatcataatattggacccagccatttctattcatgatctccgcaataatacaccc
tatgagacctatagaaggggcaatgagatgaaagtgtgggtcaatgagtcagatggaata
aagcctctcattggagaagtgtggccaggaatatgtgtctatcccgatttttccaatcct
gatactgttacatggtggtctaatgagtgtgacacttttcacaaaactattccgtttgat
ggattgtggattgatatgaatgaagtatcaaattttgttaaaggatccacatctggctgt
gcacaaaacaacttgaattatccaccatttactccaaaaattcttgatggtgtcatgtac
tcaaaaacactttgtatggatgcagtgcagaaggcaggcaaacactatgatgtacacagc
ctctatggatttttcatgactactgctactgatcaagctctccaaactgttttccctggc
aagagaagccttcttctttctcgatctacttttgctggatctggaaaattctcagggcac
tggctgggtgataatgatgccacctggaataatatgaaatgggccataccaggaatgatg
gaatttaatctttttggctacccttatattggagcagatatttgtggatttctcctaaat
gccacagaagaactttgtagacggtggttacaagttggcgcattttacccattttcaagg
aatcacaatggtgaaaacaatgatcataatgatcctgcatcttttgggaaagactctctc
ttggtgaattcaaccaaacattatctaaacatacgttacaccttgttaccatatctctac
accctcttttataaagcacatgcccatggagagacagttgtgagacctgttctacatgag
ttttactcagatgaagccacttgggctattgacagacagttcttgtggggacctgggctg
cttattactccagtcctggatgagggtgcaaacacagtggatgcctatatgcctgatgct
gtgtggtatgagtatgaaacaggcagaaaggcaatttggaggaaacaacaatgtcagatg
tatctcccagcagacaaactaggacttcatctcagaggaggctacatctttcctactcaa
caaccagctaacacaactgttttcagtcgtgtaaaccctatggggcttataattgcctta
aatgacaacggaacagcaacaggagaattgttctgggatgatggagaaaccagaggtaca
gtggaaaataaagcctacctcttatatcaatttagtgtctccaatgatgtcttaactatg
tctgtggcacacaatggttaccaagacccaaaaaacttagaatttcaggaagtcaagatc
tttggattatctctagaacttacagaagtgaaagtcacatcaaacaacgtggctcagaat
tatcctgtcaacgtcaattatattgctgcagataaggttgcccatataacaggtcttcag
cttaaactaggtgaaccacacacagtctcctggaaccaagtctctaaagacagtgataaa
tttgattgttatccttatcaagatgcaacacaagcaaattgtcaagcgctaggctgtatc
tgggaggcttcccctactccaggagttccatactgttacttccataacaatgctggttat
actgttgacaaggttcagtacacatcttctggttttactgcagaccttagcacaagccag
agatcttttagatctgcaaaactggccataactcctattaacacactgcgcttggaggtt
aaatatcatgaaaaccacatgcttcagtttaagatttttgattatagtaataaaagatat
gaagttcctgtcccattgaacctccccagcactcctgcaagcacccctgaaaatcgtctc
tatgatgtttcagttcaaaacaatccatttggtatacaaattcagcgcagaagcactggg
acagtcatctgggattcacaattacctagtttcatcttcagtgacatgttcattcagatt
tcaactcgtttaccatcacagtatgtatatggctttggggaaacagagcacaaacaatac
cggcatgaaatggactggcatacttggccaatgtttgcaagggatcagtctcctggatac
aaatttaacacttatggagttcagcccttttacatgggtttggaaaatgatggaaatgct
catggagttcttttgctgaacagtaatggaatggaggtgaaattacagcctaccccagct
ttgacttaccgtaccctaggagggattttggacttctatgtagtgctgggcccaactcca
gaacaagttgttcagcaatacactgcacttattggacgcccggtcatgcctccctattgg
ggtttaggattccagttgagccgttatggatatgaaaatgacggagaaatctctaatttg
tacaatgacatgaaggcagctaaaattccttatgatgtacagtatgcagatattgattat
atggagcggcagatggatttcacactcagtcccaaattttcaaaccttccatctttggtt
gacaggattaaagaggatggcatgagatttgtcatcattttggatccagccatttcagga
aatgaaactaattatccagcattcacgagaggtgttcaggaagatgtcttcattaaatgg
cccaatggcagtggtatcgtgtgggggaaggtatggccttatttgcctgatgtcgttgtg
gatccatctctaggctgggatgaaaaagtagaaaaatactgtgcttgggctgcattccca
gattttttccgtgagtctacagctgactggtggaaaagggaaatccaggaattccacact
aaccctacaaacccagagaaaagtattaaatttgatggattatggattgatatgaatgaa
ccatccaattttgtcaatggtgcagttcatggctgtggggactctgagctaaattttcct
ccatacatgccaggcattgagggaaaggatgcaggattgtgtagcaaaaccctgtgcatg
cagagtcaacagcttctgcctgatggaactcagcttcgacactatgacgttcacaatata
tatgggtggtctcaaactaagcctacatatgatgcccttcacagtgtcactggacaacgt
ggcatcgtcattactcgttcaacatatccttcgagtggcaagtgggcaggacattggctt
ggtgataacttctccctgtgggatcagctttacaaatctataataggcatgatggaattt
agcctctttggaatgtcatatactggtgcagatatctgtggcttcaactatgatagcaat
taccaaatgtgtgcccgatggacacaactgggcgccttttacccgtattccagaaaccat
aatggcataggatatttgaggcaagatcctgcagcctttgatgaaaaatttcaagaaata
tccagaaatgtgctcaataccagatatactttgcttccctatctttacacactgatgtat
gaagcacatgcccatggtaacacagttgtgcggcctttactacatgaatttgtagatgat
aaagtcacatgggagatatatgaacagtttctctggggacctgcattgcttattagccct
gcactgcatccaaatgttacagaagtgaatgcttattttcccgatgcccgctggtataat
tattacactaatgaagttgagggaataagaaaagaattccagaacttagccactcccctt
gagcacatcaaccttcatctcagaggaggcaacatcatcccatggcaactccctgctttg
aatacccaggccagccgaaaaaatatgatgggtcttacagtagctttggatgataatggg
gctgcacagggacttctatattgggatgatggaacaacaattgatgcatatgagaaaggt
ctttatcttctgcatacctttaatgccagtcagaatgtgttgaacattggtattgctcac
caaagatattttgatccaaacaatttgaaattcggtgaaattaaaatccttggagtagta
tccactatcactcctgttgttatagtgcttcagaatggtgcagaaattccatccagtcac
agcgcaacctataatgtttcatctcaggtcttacacattacaggcttgcaacttgcagtt
gggcaagaatatacactgaggtgggaaccaaaggtgtttcaagatacagacaaatttaac
tgtcatccatacccagaaccaacacaaagcacttgtgaagctcgtggctgcatctgggag
gttgtttctactcctggagtgccacactgtttttatcccagtaattatgggtattctgtc
agtaatattcaaaccactgctgtgggcttgacagctgacctccacaggaacactgagttt
cctaacccatatggttctaggtcaccagcagtggacctgcttcgtttggaagtgacatat
cattacaacgacatgctgcagtttaagatctatgatcccaacaataaaagatatgaagtt
ccagtccccctcttcaccccaaacaaccctgaaagtacagatgctgatcggctctatcaa
gtagaaattgtcaacaatccatttggcatacagatcaaaaggaaaagtacaggcagtgtt
atctggaattcccaggtcccaggcttcaccttcagtgacatgttcattcagattgctaca
ctcctgccatcacagtatgtatacggatttggagaaaatgaacacactcatttccggaga
gatatgaattgggagacttggggaatgttcaccaaagatcaacctccaggatacaaactg
aattcgtatggtttccaacccttctacatgggaatggaaaatgatggaagtgctcatgga
gttcttttgctgaacagtaatgctatggatgtcaccttccaaccaacacctgccctcaca
tatcgcacaattggaggaattctggacttttatatggttttagggccaaacccagaagaa
gttgttcaagaatataccagacttataggaagaccagtcatgccaccttattgggccttg
ggattccagctttgccgctatggatacaaaaatacttctgaagtccgtgatctctataat
gaaatgagagctgctaaaataccatatgatgtgcaatatacagacattaattacatggaa
aggaagctagattttactcttagcaaagacttcagtgatcttcctgattttatcaatgaa
ataaaagccgatggttcaagattcatcatcatcctggatccagcaatttcaggaaatgaa
acttcatcatatgagacatttaccaaaggtttgcagaacaaggtcttcgttacatggcct
aatagcacagacatcgcttgggctaaggtgtggccagattatcctaatgtaacatatcct
gaagactcaagtttagaagaacaacttgcgtgctgccgagctgatgtcgctttccctgat
tatttccgcccttccaccgcacagtggtggcaagaagaaatagaaaattaccatgccagt
gttctacaatttgatggcctatggacggacatgaatgaaccatccaacttcattgatgga
gctattggtggctgcagaaatccagatttaaattaccctccatatatgccagcattggtc
ttaagagagagaggactgagtcttgttacgatgtgcatggaaagtgaacagcaacttccg
aatgggacacctgtgagacattacgatgtacataatctgtatggatggtcacaagcagag
tccacttactatggtatgcgcaatgccacaggagaacgtggcatcattatcacccggtca
acatatccatccagtggtcgatgggcaggacattggctcggagacaactatgccagatgg
gatcagcttgataaatctgttattggtatcttggaattcagcctttttggaatctcttat
tctggtgctgacatctgtggattcttcaatgatacaacctatgaaatgtgtgcccgatgg
atggagcttggagccttttacactttctcccgaaatcataatgtgttgttaactcggaga
caagatcctgtcgcctttaactcaacatttgaagatatctcacggaacgtgcttaacata
cgatacagattgctgccctatctctatactttaatgcataatgcccatgttgatggcagc
acagtttcacgtcctttgctgcatgagtttcctaatgacaagacaacctgggacatctac
aagcaattcttatggggaccagcattgatgattagtcctgtacttgatcaaggtgaagtg
acagtaaatgcttacataccagatgcacgatggtatgattatcatacgggggcagatatt
aaagtgcgaaaacaattcaagacgttggaagcacctttagagcatatcaatcttcatatc
cgaggtggctatgtaattccctggcaggtgcctaatatcactaccaatgccagccgacaa
aaccccatgggccttaccattgctttggatgacaatggagtcgcccgaggacaacttttt
tgggatgatggaattagtattgatacatatgaaaatggtgactactacttctcaagattt
caagtatctgagaatacactgaatgtttctgtggaccacaacaactatttaactgacaca
gttgatttgacaattggttatctgcacgtctggggacttacagcaccagttactgatgtt
actgttacttatgatgggatgacagaaactgctagtcatcagtatgatttaacaaatcag
atacttgaagttgacctcactggcaaaaattatcttatctacaaattaagtcaagtgaaa
tgggtgacaaccacttag

DBGET integrated database retrieval system