KEGG   Anolis carolinensis (green anole): 100563205Help
Entry
100563205         CDS       T01608                                 

Gene name
mgam
Definition
maltase-glucoamylase (alpha-glucosidase)
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:acs00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:acs00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1790 aa AA seqDB search
MGDLHLDPDKMGKKKFSGLEVTLITLFILVVIVACALIGLLATGHSGLKAGLSLCMERED
GIILLLLLLLLLLLLLLLLLLTIIIIHTVMLLTLLFFIHNIKSLCTLRGCCWNPQNETFI
PWCYFSNSHGYKADGGQKQTNTGFEVKLKRLPAPSLFGADVGEILLTAEYQTANRFRFKI
TDPAYNRYEVPHTNVKPFVGPKASNPNYRVEITESPFSIQVIRNTNNKVLFDTSIGPLVY
ADQFLQLSIRLPSENVYGIGEHVHKQYRHDFNWKTWSIFTRDALPLGAMDNLYGAQPFFL
CLEDASGHSFGVFLMNSNAMDFALQPAPAVTYRTIGGILDFYIFLGNTPEQVVQEYLTLI
GLPWMPSYWNLGFQICRWDYADLDDVKAAVERNRAAGIPFDVQYTDIDYMEDTKDFTYDK
IKFAGLPEFAQDLHDHGQKYIIILDPAISIHDLRNNTPYETYRRGNEMKVWVNESDGIKP
LIGEVWPGICVYPDFSNPDTVTWWSNECDTFHKTIPFDGLWIDMNEVSNFVKGSTSGCAQ
NNLNYPPFTPKILDGVMYSKTLCMDAVQKAGKHYDVHSLYGFFMTTATDQALQTVFPGKR
SLLLSRSTFAGSGKFSGHWLGDNDATWNNMKWAIPGMMEFNLFGYPYIGADICGFLLNAT
EELCRRWLQVGAFYPFSRNHNGENNDHNDPASFGKDSLLVNSTKHYLNIRYTLLPYLYTL
FYKAHAHGETVVRPVLHEFYSDEATWAIDRQFLWGPGLLITPVLDEGANTVDAYMPDAVW
YEYETGRKAIWRKQQCQMYLPADKLGLHLRGGYIFPTQQPANTTVFSRVNPMGLIIALND
NGTATGELFWDDGETRGTVENKAYLLYQFSVSNDVLTMSVAHNGYQDPKNLEFQEVKIFG
LSLELTEVKVTSNNVAQNYPVNVNYIAADKVAHITGLQLKLGEPHTVSWNQVSKDSDKFD
CYPYQDATQANCQALGCIWEASPTPGVPYCYFHNNAGYTVDKVQYTSSGFTADLSTSQRS
FRSAKLAITPINTLRLEVKYHENHMLQFKIFDYSNKRYEVPVPLNLPSTPASTPENRLYD
VSVQNNPFGIQIQRRSTGTVIWDSQLPSFIFSDMFIQISTRLPSQYVYGFGETEHKQYRH
EMDWHTWPMFARDQSPGYKFNTYGVQPFYMGLENDGNAHGVLLLNSNGMEVKLQPTPALT
YRTLGGILDFYVVLGPTPEQVVQQYTALIGRPVMPPYWGLGFQLSRYGYENDGEISNLYN
DMKAAKIPYDVQYADIDYMERQMDFTLSPKFSNLPSLVDRIKEDGMRFVIILDPAISGNE
TNYPAFTRGVQEDVFIKWPNGSGIVWGKVWPYLPDVVVDPSLGWDEKVEKYCAWAAFPDF
FRESTADWWKREIQEFHTNPTNPEKSIKFDGLWIDMNEPSNFVNGAVHGCGDSELNFPPY
MPGIEGKDAGLCSKTLCMQSQQLLPDGTQLRHYDVHNIYGWSQTKPTYDALHSVTGQRGI
VITRSTYPSSGKWAGHWLGDNFSLWDQLYKSIIGMMEFSLFGMSYTGADICGFNYDSNYQ
MCARWTQLGAFYPYSRNHNGIGYLRQDPAAFDEKFQEISRNVLNTRYTLLPYLYTLMYEA
HAHGNTVVRPLLHEFVDDKVTWEIYEQFLWGPALLISPALHPNVTEVNAYFPDARWYNYY
TGIRKEFQNLATPLEHINLHLRGGNIIPWQLPALNTQASRKNMMGLTVALDDNGAAQGLL
YWDDGTTIDAYEKGLYLLHTFNASQVCIMYLKQLKELEPDVTKITSHAMH
NT seq 5373 nt NT seq  +upstreamnt  +downstreamnt
atgggggatcttcatctcgatcctgacaaaatgggtaagaagaaattcagtggattagaa
gtcactctgatcactctcttcattttggtggtgattgtagcttgtgccttgattggactt
ctagcaacaggtcattctggtctcaaagctggcttgagtctctgtatggagagagaagac
gggataatattattattattattattattattattattattattattattattattatta
ttaacaataataataattcacacagtgatgctattaactttgcttttttttattcataat
ataaagagtctctgcacacttcgtggctgctgctggaatcctcagaatgaaacattcatc
ccttggtgctacttttctaatagtcatgggtacaaagctgatggaggccaaaaacagaca
aatacaggatttgaagttaaactaaaaagattgcctgcgccatccctgtttggagctgat
gttggagaaattctcttaactgcagaatatcagacagcaaaccgctttcggttcaagatt
acagatcctgcttataatagatatgaagttccacataccaatgttaaaccctttgtggga
cccaaagcaagcaatccaaactacagggttgaaattactgaaagtcctttcagcatccaa
gtgattaggaataccaataataaagttctctttgacaccagcattggaccacttgtgtat
gccgaccagttcttgcaactctccatcagactacccagtgaaaatgtttatggaattgga
gaacatgttcacaaacagtataggcatgactttaactggaaaacatggtcaatatttact
cgggatgctctacctcttggagctatggataacctttatggtgctcagcctttcttcttg
tgtctggaagatgccagtggacactcttttggtgtattcttgatgaacagcaatgccatg
gattttgctctccaacctgccccagcggttacatacagaacaattggtggaattctagat
ttctacatattcttgggaaacactccagaacaggttgtccaagaatatctaacgctgata
ggacttccatggatgccatcatactggaatctgggatttcagatctgtcgctgggattat
gctgatcttgatgatgtaaaagctgctgtggaaaggaatagggcagctggaatacctttt
gatgttcaatacactgatattgactacatggaagataccaaagattttacctatgacaaa
ataaaatttgcaggccttcctgagtttgctcaagaccttcatgaccatggacagaaatac
atcataatattggacccagccatttctattcatgatctccgcaataatacaccctatgag
acctatagaaggggcaatgagatgaaagtgtgggtcaatgagtcagatggaataaagcct
ctcattggagaagtgtggccaggaatatgtgtctatcccgatttttccaatcctgatact
gttacatggtggtctaatgagtgtgacacttttcacaaaactattccgtttgatggattg
tggattgatatgaatgaagtatcaaattttgttaaaggatccacatctggctgtgcacaa
aacaacttgaattatccaccatttactccaaaaattcttgatggtgtcatgtactcaaaa
acactttgtatggatgcagtgcagaaggcaggcaaacactatgatgtacacagcctctat
ggatttttcatgactactgctactgatcaagctctccaaactgttttccctggcaagaga
agccttcttctttctcgatctacttttgctggatctggaaaattctcagggcactggctg
ggtgataatgatgccacctggaataatatgaaatgggccataccaggaatgatggaattt
aatctttttggctacccttatattggagcagatatttgtggatttctcctaaatgccaca
gaagaactttgtagacggtggttacaagttggcgcattttacccattttcaaggaatcac
aatggtgaaaacaatgatcataatgatcctgcatcttttgggaaagactctctcttggtg
aattcaaccaaacattatctaaacatacgttacaccttgttaccatatctctacaccctc
ttttataaagcacatgcccatggagagacagttgtgagacctgttctacatgagttttac
tcagatgaagccacttgggctattgacagacagttcttgtggggacctgggctgcttatt
actccagtcctggatgagggtgcaaacacagtggatgcctatatgcctgatgctgtgtgg
tatgagtatgaaacaggcagaaaggcaatttggaggaaacaacaatgtcagatgtatctc
ccagcagacaaactaggacttcatctcagaggaggctacatctttcctactcaacaacca
gctaacacaactgttttcagtcgtgtaaaccctatggggcttataattgccttaaatgac
aacggaacagcaacaggagaattgttctgggatgatggagaaaccagaggtacagtggaa
aataaagcctacctcttatatcaatttagtgtctccaatgatgtcttaactatgtctgtg
gcacacaatggttaccaagacccaaaaaacttagaatttcaggaagtcaagatctttgga
ttatctctagaacttacagaagtgaaagtcacatcaaacaacgtggctcagaattatcct
gtcaacgtcaattatattgctgcagataaggttgcccatataacaggtcttcagcttaaa
ctaggtgaaccacacacagtctcctggaaccaagtctctaaagacagtgataaatttgat
tgttatccttatcaagatgcaacacaagcaaattgtcaagcgctaggctgtatctgggag
gcttcccctactccaggagttccatactgttacttccataacaatgctggttatactgtt
gacaaggttcagtacacatcttctggttttactgcagaccttagcacaagccagagatct
tttagatctgcaaaactggccataactcctattaacacactgcgcttggaggttaaatat
catgaaaaccacatgcttcagtttaagatttttgattatagtaataaaagatatgaagtt
cctgtcccattgaacctccccagcactcctgcaagcacccctgaaaatcgtctctatgat
gtttcagttcaaaacaatccatttggtatacaaattcagcgcagaagcactgggacagtc
atctgggattcacaattacctagtttcatcttcagtgacatgttcattcagatttcaact
cgtttaccatcacagtatgtatatggctttggggaaacagagcacaaacaataccggcat
gaaatggactggcatacttggccaatgtttgcaagggatcagtctcctggatacaaattt
aacacttatggagttcagcccttttacatgggtttggaaaatgatggaaatgctcatgga
gttcttttgctgaacagtaatggaatggaggtgaaattacagcctaccccagctttgact
taccgtaccctaggagggattttggacttctatgtagtgctgggcccaactccagaacaa
gttgttcagcaatacactgcacttattggacgcccggtcatgcctccctattggggttta
ggattccagttgagccgttatggatatgaaaatgacggagaaatctctaatttgtacaat
gacatgaaggcagctaaaattccttatgatgtacagtatgcagatattgattatatggag
cggcagatggatttcacactcagtcccaaattttcaaaccttccatctttggttgacagg
attaaagaggatggcatgagatttgtcatcattttggatccagccatttcaggaaatgaa
actaattatccagcattcacgagaggtgttcaggaagatgtcttcattaaatggcccaat
ggcagtggtatcgtgtgggggaaggtatggccttatttgcctgatgtcgttgtggatcca
tctctaggctgggatgaaaaagtagaaaaatactgtgcttgggctgcattcccagatttt
ttccgtgagtctacagctgactggtggaaaagggaaatccaggaattccacactaaccct
acaaacccagagaaaagtattaaatttgatggattatggattgatatgaatgaaccatcc
aattttgtcaatggtgcagttcatggctgtggggactctgagctaaattttcctccatac
atgccaggcattgagggaaaggatgcaggattgtgtagcaaaaccctgtgcatgcagagt
caacagcttctgcctgatggaactcagcttcgacactatgacgttcacaatatatatggg
tggtctcaaactaagcctacatatgatgcccttcacagtgtcactggacaacgtggcatc
gtcattactcgttcaacatatccttcgagtggcaagtgggcaggacattggcttggtgat
aacttctccctgtgggatcagctttacaaatctataataggcatgatggaatttagcctc
tttggaatgtcatatactggtgcagatatctgtggcttcaactatgatagcaattaccaa
atgtgtgcccgatggacacaactgggcgccttttacccgtattccagaaaccataatggc
ataggatatttgaggcaagatcctgcagcctttgatgaaaaatttcaagaaatatccaga
aatgtgctcaataccagatatactttgcttccctatctttacacactgatgtatgaagca
catgcccatggtaacacagttgtgcggcctttactacatgaatttgtagatgataaagtc
acatgggagatatatgaacagtttctctggggacctgcattgcttattagccctgcactg
catccaaatgttacagaagtgaatgcttattttcccgatgcccgctggtataattattac
actggaataagaaaagaattccagaacttagccactccccttgagcacatcaaccttcat
ctcagaggaggcaacatcatcccatggcaactccctgctttgaatacccaggccagccga
aaaaatatgatgggtcttacagtagctttggatgataatggggctgcacagggacttcta
tattgggatgatggaacaacaattgatgcatatgagaaaggtctttatcttctgcatacc
tttaatgccagtcaggtatgtataatgtatcttaagcagcttaaagaacttgaaccagat
gtcaccaaaattacttcacatgcaatgcactaa

DBGET integrated database retrieval system