KEGG   Anolis carolinensis (green anole): 100563206Help
Entry
100563206         CDS       T01608                                 

Definition
delta-1-pyrroline-5-carboxylate synthase-like
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:acs01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:acs00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 1103 aa AA seqDB search
MELTLQLLLLLFLSVSGLSKAQTEEENVTLNAEEVSSTSKPEESSSTLKAEDINSTLGAE
NSTLKAEEPPTEAARPSETPGVQREEESPESPGAKLNYLQKPQLVTKENFPALSAEYGGS
SFILPEQVQSSPASFYQVGDPIQTYFASSSMLSVLKQPVGIGVSQLCLDENSAGFLESKS
TNCLRIFTDLLKSCTTDPVLDAASYYRNFTVLKVNITALSEPPSPSLIDGICHNVVTEVS
YEVQFNGILGIQEVSVQFKVANISGNPRATVQQHFFLHFWEETTSSSNYPDYFVEAQDIE
NIRPFTMLYRASLLPSLRSSGRFWRQSDVAGSHPCLLAPNLVLRNTCARGWSNIPFITVP
LSRTHGKSFAHRSELKHAKRIAVKLGSAVVTRGDECGLALGRLASIVEQVKVLQNQGREM
MIVTSGAVAFGKQRLRHEILLSQSVRQALHSGQNQLKDMAIPVLEARACAAAGQSGLMAL
YEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDAVVPPPEPN
SDLQGVISVKDNDSLAARLAVEMKTDLLIILSDVEGLFDSPPGSDDAKLIDIFYPGDQQS
VTFGNKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKISGHVITDIVEGKKVGTFFS
EVKPAGPTVEQQAEMARAGGRSLAALQPEQRAEIIYHLADLLTDQREEILQANRKDLEEA
ESKGRLALPLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKDLELEQVTVP
IGVLLVIFESRPDCLPQVSALAIASGNGLLLKGGKEASYSNQLLHHLTQEALSIHGVKDA
VQLVNTREEVEDLCRLDKLIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHVYVDLEA
SVEKVTRIVRDSKCEYPAACNALETLLIHRDLLRTPVFDQIIDMLRVEQVKIHAGPKFAS
YLTFSPSEVKSLRTEYGDLECCIEVVDSAQDAVEHIHKYGSSHTDVIITENEKTAEFFLQ
HLDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGIEGLLTTKWLLRGQNHIVS
DFSEQGSMKFLHENLPIPQRNTN
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atggaactcacgctgcagttgcttctcctcctcttcctctcagtgtcaggtttgtcgaag
gcccagacggaggaggaaaacgttactctgaacgccgaggaagtaagcagtacttcgaag
ccagaagaaagtagcagcactctgaaggcggaggacattaacagtactttgggggcggag
aacagtaccctgaaggccgaggagccccctacagaagcggcgcgccccagcgagacgccc
ggagtccagagggaagaagagagccctgagtctccaggcgcaaaactgaactacttacag
aaaccacaactggttacaaaagaaaacttcccagcactttcagcagaatatggagggtca
tccttcatattaccagaacaagttcagtcatctcctgcttccttttaccaggtgggggat
ccaattcagacatactttgcttcatcatctatgttgagtgtgctcaaacaacctgtgggt
ataggagtcagccagctttgtctagatgagaattctgctggttttctggagagtaaaagt
acaaactgtttacgaatctttactgacctgttgaaaagctgcactactgatcctgtattg
gatgcagcttcatattaccgtaatttcactgtgctaaaggttaacatcactgcactctca
gagcctccttctccttcactgattgatggcatctgccacaatgttgttactgaggtgtcc
tatgaggtgcagttcaatgggatccttgggattcaagaggtttctgttcagttcaaagtg
gctaatatatctgggaatccaagagctacagtgcagcagcacttctttctgcatttttgg
gaggagaccacttccagttcaaactacccagactactttgttgaagctcaagatattgaa
aacatcaggccattcacaatgctgtaccgtgcttctcttcttccttctctacgttcctca
ggacgattctggcggcaatctgatgtagctggctcccacccctgtcttctggctcctaac
ctggtcttgaggaatacgtgcgcccgaggttggagtaacataccttttatcacagtgcct
ctcagccgaacccatggcaagtcatttgcgcaccgcagcgaactgaagcatgccaagcga
attgcggtgaaactagggagtgctgttgtgactcgaggagatgaatgtggccttgccttg
gggcgcctggcatccatcgttgagcaggtaaaagtgctacaaaaccagggccgggaaatg
atgattgttaccagtggggctgtagcctttggcaaacagcgcctccgccatgagatcctg
ctctcacagagtgtgaggcaagctctccactcgggacagaatcagcttaaggacatggcc
atccctgtgctagaggctcgagcctgtgccgcggctggtcagagtgggttgatggcacta
tatgaagccatgttcactcagtacagcatctgtgctgcccagatactggtcaccaatttg
gattttcatgatgagcagaagcgtcgaaatttaaatggaactttacatgaactattaagg
atgaacattgttcccatcatcaacaccaatgatgctgtggttcctcccccagaaccaaac
agtgatctacagggggtaatcagtgtgaaggacaacgatagcttagcagcacggctagca
gtggaaatgaagaccgacctgctgatcattctttcagatgtcgagggtctctttgacagc
ccccctggatcagatgatgcaaagctcattgacatattttaccccggagatcagcagtcc
gtgacatttggaaacaaatcgcgagtgggaatgggtggcatggaggccaaggtgaaagca
gccttgtgggctctccaaggaggtacctcagtagtgattgcaaatggaactcaccctaag
atctctggccatgtcattactgacattgtagaagggaaaaaagttggcaccttcttttca
gaggtgaaacctgcaggtccaacagtggagcagcaagctgaaatggctcgagcaggaggc
aggagtttggcagcactacaacctgaacagagagcagaaatcatctatcatcttgctgac
cttctgacagaccagagagaagagattcttcaagccaacagaaaggatctggaagaagcc
gagagcaaaggaagactggctctacctctgttgaagagactcagtctgtcaacttccaag
ctgaatagtttggccattgggttacgtcagattgcagcgtcttcacaggacagtgttggc
cgggtcctccgaagaacacgaattgcaaaggatttggagctcgagcaagtgactgtaccc
atcggggtcttactagtaattttcgaatctcgacccgactgtcttccccaggtatctgca
ttggctattgctagtggaaatggtttgttgcttaaaggaggaaaagaggcatcatatagt
aatcaactccttcaccacttgactcaggaagcactttctatccatggtgtgaaagatgca
gtgcagctggtaaataccagggaagaagtggaagacctttgtcgtttagacaagctgata
gatctgattatcccccgtggctcatctcagttggtacgggatatccagaaagctgctaaa
ggaatcccagtaatgggtcacagtgaagggatttgtcatgtgtatgtggatcttgaagcc
agtgttgagaaggtcaccagaatagtgagagactcaaaatgtgaatatcctgcagcctgc
aatgcactggagaccttgttgatacaccgggatttgttgagaacccctgtgtttgaccag
ataattgacatgctgcgtgtggagcaggtgaaaattcatgcgggccccaaatttgcctca
tatctgacgtttagtccctcagaggtgaaatccctccgcacagaatatggggacctggag
tgctgtattgaagtcgtggacagtgcgcaggatgctgttgaacacatccacaagtatggg
agttcccatacggatgtcatcattacagaaaatgagaaaacagctgaattcttccttcag
catctggatagcgcctgtgtgttctggaacgccagcacccgcttctctgatggctatcgc
tttgggctaggggctgaggttggcatcagcacatcgcgcatccatgcccgtgggccagtg
ggaatcgaggggctgttgacgaccaaatggttgctaagagggcagaaccacatcgtttct
gatttctcagagcagggaagcatgaaattccttcatgaaaaccttcccattcctcagagg
aacaccaactga

DBGET integrated database retrieval system