KEGG   Anolis carolinensis (green anole): 100563485Help
Entry
100563485         CDS       T01608                                 

Gene name
eif4e2
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 2
  KO
K03259  
translation initiation factor 4E
Organism
acs  Anolis carolinensis (green anole)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100563485 (eif4e2)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100563485 (eif4e2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100563485 (eif4e2)
Messenger RNA biogenesis [BR:acs03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100563485 (eif4e2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100563485 (eif4e2)
Translation factors [BR:acs03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100563485 (eif4e2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 256 aa AA seqDB search
MEAEERKSGAGSKAAAGERPRRMNNKFDALKDDDSGDHEQNEENNTQKDGEKEKNDRDKS
QSSIKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFY
SHMIRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGE
QFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHT
DSIKDNSSFRNTKIAL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggaggagcggaagtccggcgcaggaagcaaagcagcggctggcgaacgaccg
aggaggatgaacaacaaattcgacgctttgaaggatgatgacagtggagatcatgagcag
aatgaagagaacaacacacagaaagatggtgagaaggaaaaaaacgatagagacaaatcc
caaagtagcatcaagaggaaggctgtggtaccaggaccggcggagcatcctctgcagtat
aattacaccttctggtactccagacggacgcctgggaggcccaccagctctcagagttat
gaacagaacatcaaacaaattggcacctttgcttccgtggagcagttctggaggttttat
agccacatgatccgtcccggggacctgaccggccacagcgactttcatcttttcaaagaa
ggaattaaacccatgtgggaagatgatgccaacaagaatgggggcaagtggattatccgc
cttcgaaagggcttagcatctcggtgctgggagaaccttattctcgcaatgctgggagaa
caattcatggtgggggaagagatctgtggggcagttgtatctgttcgttttcaggaggat
atcatttccatatggaacaagacagccagtgaccaagcgaccacagcccggataagggac
acattacgacgagtgctcaaccttcctcctaacaccatcatggaatacaaaacacacaca
gacagcatcaaggataattcaagcttccggaataccaagattgcactgtga

DBGET integrated database retrieval system