KEGG   Anolis carolinensis (green anole): 100563584Help
Entry
100563584         CDS       T01608                                 

Definition
thrombospondin-2-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
acs  Anolis carolinensis (green anole)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:acs04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:acs04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:acs04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1184 aa AA seqDB search
MLHRSWLLWLTILLTLWISSEAQDEDGGDETTYDLMQISNINRKTIGAKAFRGNISGVPA
YRFIRFDHIPPLNSEKLKQIVKLIQQNEGFILTATFRQDRDSRGTIIALEGPGISQRQFE
IISNGRDNTLELSYWVDGSRKGYPLEDVDLADLQWKNITIQVLGENYSLYVGCDLIDSLS
LEEPFYENLKAEKSRMYVVKGSTRENHFRGLIQNIHLIFGTSVEDVLRNKGCQKSQSAEV
NTINESTEILHLTPSVMTEYIGDNTEKKPEFCDRSCEELGSMFTELTGLRIVVNGLTEKL
EKVSEVNEKIVSELLGPNKTLKNQSACWQDGREFVNNSHWVVDSCTKCHCQNSKTVCNKI
TCPPVHCVSPAFIDGECCPVCSHSDDSEEGWSPWSEWTECSVTCGSGTQQRGRSCDVTSN
TCRGPSIQTRTCSLGKCDNRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPIPQMGG
KGCKGSGRETKECEGPPCPVNGRWSPWSPWSACTVTCGGGIHERSRLCNSPEPQYGGKPC
VGDVIQRDMCNKQDCPIDGCLSNPCFPGADCNSYPDGSWSCGACPAGYLGNGTFCEDLNE
CAVVPDVCFKLNQNHRCVNTNPGFHCLPCPPRYKGTQPYGVGLEAARAEKQVCEPANPCK
DKTHNCHRSAECIYLGHFSDPMYKCECRTGYAGDGFICGEDSDLDGWPNNNLVCAANATY
HCMKDNCPLLPNSGQEDFDKDGKGDACDEDDDNDGVEDDKDNCPLLFNPRQFDYDKDEVG
DRCDNCPYVHNPAQIDTDNNGEGDACAVDIDGDDVFNARDNCPYVYNTDQIDTDGDGVGD
QCDNCPLVHNPEQTDVDNDLVGDQCDNNEDIDEDGHQNNKDNCPYISNANQADHDKDGKG
DACDPDDDNDGIPDDRDNCRLTFNPDQKDSDGDGRGDICKDDFDNDKVPDIYDVCPENDA
ISETDFRKFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGYDEFSSVDFSGT
FYVNTDRDDDYAGFVFAYQSSSRFYVLMWKQVTQTYWEDKPTRAYGYSGVSLKVVNSTTG
TGEHLRNALWHTGNTAGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGLIKVLVYEGKQI
MADSGAIYDKTYAGGRLGLFVFSQEMVYFSDLKYECRAMEKQQP
NT seq 3555 nt NT seq  +upstreamnt  +downstreamnt
atgttacaccggagttggctactgtggctgacaatcttgttaactttgtggatttcatca
gaggctcaagatgaagatggaggggatgaaactacatatgacttgatgcaaatcagcaac
atcaacaggaagaccattggagcaaaagcattcaggggtaatatttctggggttccagcg
taccgcttcatccggtttgatcatatacctccacttaactctgagaaattaaaacagatt
gttaaactgatccaacaaaatgaaggattcattcttactgccaccttcaggcaagacagg
gactccaggggcaccatcattgctttggaaggccctggcatctctcagcggcaatttgaa
attatttccaatggccgagacaatacacttgagctttcttattgggtagatggttcccgg
aaggggtatcctttggaagatgtggacctagctgatctacagtggaaaaatataactata
caagtattaggagaaaactacagcctgtatgttggatgtgacctcattgacagcttaagc
ctggaagagcctttttatgaaaacctgaaagcagagaaaagtagaatgtacgtggtgaaa
ggatctacaagagagaaccactttcggggtctcatacaaaatattcatctgatttttgga
acttcagtagaggatgtgttacgtaacaaaggatgccagaagagccaatcagctgaagtg
aacaccatcaatgagagcacagaaatccttcatctcaccccttcggtcatgacagaatac
attggggacaatactgagaagaagccagaattctgtgatcgctcttgtgaagagcttggg
tctatgtttactgaactcactgggttgcgcattgttgtcaatggcttaactgaaaagtta
gaaaaagtgtctgaagtgaatgaaaaaattgtgtcagaattgcttggcccaaacaagaca
ctgaagaaccaatcagcatgttggcaagatggtcgtgaatttgtaaacaattcacactgg
gtggtggacagctgtacaaaatgtcactgtcagaactctaaaacagtatgcaataaaatc
acatgccccccggtgcactgtgtcagcccagctttcattgatggcgaatgttgtcctgtc
tgctcccactctgatgacagtgaagaaggctggtccccttggtctgagtggacagaatgc
tctgtcacatgtggatctggaacccaacagcgggggaggtcatgtgatgttaccagtaac
acttgtcgaggcccctccattcaaaccaggacgtgttctcttggcaaatgtgacaatcgt
atacgtcaagatgggggctggagccactggtctccttggtcttcctgttctgtgacctgt
ggagtaggcaacataactcgcatacgtctctgcaactcccctatcccacagatgggtggg
aaaggctgcaaaggaagtgggcgtgaaaccaaagaatgtgaaggaccaccatgtccagtt
aatggtcgatggagcccttggtctccctggtctgcttgtacagttacctgtggaggaggt
attcatgagagatctcgtctctgtaatagcccagaacctcagtatggaggaaagccctgt
gtgggagatgttatacagcgagatatgtgcaataaacaggattgcccaatagatggatgc
ttgtcaaatccttgcttcccaggagcagactgcaacagctaccctgatggttcttggtct
tgcggtgcatgtcctgctggatatcttggaaatggaacgttttgcgaggacctcaatgag
tgtgcggtagtgccagatgtttgctttaagttaaatcagaaccaccgttgtgtaaacaca
aatccaggattccattgcttgccgtgccctccacgctacaaaggaactcagccatatggg
gtaggcctggaggctgccagagcggaaaaacaagtatgtgaaccagccaatccttgcaaa
gacaaaacacacaactgccacaggtccgcagagtgcatctatttggggcatttcagtgac
cccatgtacaagtgtgaatgtaggacgggctatgctggtgatgggttcatttgtggtgaa
gactctgacctggatggatggcccaataataacctggtctgtgctgcaaatgctacttat
cactgcatgaaggataattgtccccttttacctaattctggacaagaagactttgataaa
gatgggaaaggtgatgcctgtgatgaagatgatgacaatgatggtgtagaggatgataaa
gacaactgtccccttctttttaatccccgtcaatttgactatgataaagatgaagttggt
gaccgttgtgataactgcccctatgtgcacaatcctgctcaaattgacactgataataat
ggagagggtgatgcatgtgcagtggatattgatggagatgatgttttcaatgcacgagat
aactgcccatatgtctacaacactgatcaaatagatacagatggggatggagttggtgat
caatgtgacaactgtcctctggttcacaatcctgaacagactgatgtcgataatgatctt
gttggtgaccagtgtgacaacaatgaggacattgatgaagatggtcaccagaacaacaaa
gacaactgtccgtacatttctaatgccaatcaggcagaccatgataaggatgggaaagga
gatgcttgtgatcctgatgatgacaatgatggtattccagatgacagagacaattgccgt
ctcacatttaacccggaccagaaggactctgacggtgatggccgaggtgacatctgcaaa
gatgattttgacaatgacaaagtgccagatatttatgatgtgtgtcctgaaaatgatgcc
attagtgaaactgatttcagaaagttccagatggtgcctctggaccctaaaggaacaaca
cagattgacccaaattgggtcattcgtcatcagggcaaagaacttgtacagacggctaac
tcagaccctggcatcgctgttggttatgatgaattcagttctgttgacttcagtggtaca
ttttatgtcaacacagaccgggatgatgattatgctggatttgtttttgcttaccagtct
agcagtcgcttctatgtcctgatgtggaaacaagttactcagacctattgggaagacaag
cccactagggcttatggttactcaggagtatcacttaaagtagtgaactccacaactggc
actggtgaacacttgagaaatgctctttggcatactggaaatacagctggacaggtgcgt
acattgtggcacgaccccaagaatattggctggaaagattacactgcctacaggtggcat
ttgatccataggcctaaaacaggattgataaaggttttagtatatgaagggaagcaaatc
atggcagattctggagccatctatgacaagacctatgctggtgggaggttaggtctattt
gtcttttcacaagagatggtgtacttctctgacctcaagtatgaatgtagagcaatggag
aaacagcagccatga

DBGET integrated database retrieval system