KEGG   Anolis carolinensis (green anole): 100563584Help
Entry
100563584         CDS       T01608                                 

Gene name
thbs2
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
acs  Anolis carolinensis (green anole)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100563584 (thbs2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100563584 (thbs2)
  Cellular commiunity
   04510 Focal adhesion
    100563584 (thbs2)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100563584 (thbs2)
  Exosomal proteins of colorectal cancer cells
   100563584 (thbs2)
  Exosomal proteins of bladder cancer cells
   100563584 (thbs2)
Heparan sulfate/heparin binding proteins [BR:acs00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100563584 (thbs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1179 aa AA seqDB search
MLHRSWLLWLTILLTLWISSEAQDEDGGDETTYDLMQISNINRKTIGAKAFRGNISGVPA
YRFIRFDHIPPLNSEKLKQIVKLIQQNEGFILTATFRQDRDSRGTIIALEGPGISQRQFE
IISNGRDNTLELSYWVDGSRKGYPLEDVDLADLQWKNITIQVLGENYSLYVGCDLIDSLS
LEEPFYENLKAEKSRMYVVKGSTRENHFRGLIQNIHLIFGTSVEDVLRNKGCQKSQSAEV
NTINESTEILHLTPSVMTEYIGDNTEKKPEFCDRSCEELGSMFTELTGLRIVVNGLTEKL
EKVSEVNEKIVSELLGPNKTLKNQSACWQDGREFVNNSHWVVDSCTKCHCQNSKTVCNKI
TCPPVHCVSPAFIDGECCPVCSHSDDSEEGWSPWSEWTECSVTCGSGTQQRGRSCDVTSN
TCRGPSIQTRTCSLGKCDNRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPIPQMGG
KGCKGSGRETKECEGPPCPVNGRWSPWSPWSACTVTCGGGIHERSRLCNSPEPQYGGKPC
VGDVIQRDMCNKQDCPIDGCLSNPCFPGADCNSYPDGSWSCGACPAGYLGNGTFCEDLNE
CAVVPDVCFKLNQNHRCVNTNPGFHCLPCPPRYKGTQPYGVGLEAARAEKQVCEPANPCK
DKTHNCHRSAECIYLGHFSDPMYKCECRTGYAGDGFICGEDSDLDGWPNNNLVCAANATY
HCMKDNCPLLPNSGQEDFDKDGKGDACDEDDDNDGVEDDKDNCPLLFNPRQFDYDKDEVG
DRCDNCPYVHNPAQIDTDNNGEGDACAVDIDGDDVFNARDNCPYVYNTDQIDTDGDGVGD
QCDNCPLVHNPEQTDVDNDLVGDQCDNNEDIDEDGHQNNKDNCPYISNANQADHDKDGKG
DACDPDDDNDGIPDDRDNCRLTFNPDQKDSDGDGRGDICKDDFDNDKVPDIYDVCPENDA
ISETDFRKFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGYDEFSSVDFSGT
FYVNTDRDDDYAGFVFAYQSSSRFYVLMWKQVTQTYWEDKPTRAYGYSGVSLKVVNSTTG
TGEHLRNALWHTGNTAGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGLIKVLVYEGKQI
MADSGAIYDKTYAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atgttacaccggagttggctactgtggctgacaatcttgttaactttgtggatttcatca
gaggctcaagatgaagatggaggggatgaaactacatatgacttgatgcaaatcagcaac
atcaacaggaagaccattggagcaaaagcattcaggggtaatatttctggggttccagcg
taccgcttcatccggtttgatcatatacctccacttaactctgagaaattaaaacagatt
gttaaactgatccaacaaaatgaaggattcattcttactgccaccttcaggcaagacagg
gactccaggggcaccatcattgctttggaaggccctggcatctctcagcggcaatttgaa
attatttccaatggccgagacaatacacttgagctttcttattgggtagatggttcccgg
aaggggtatcctttggaagatgtggacctagctgatctacagtggaaaaatataactata
caagtattaggagaaaactacagcctgtatgttggatgtgacctcattgacagcttaagc
ctggaagagcctttttatgaaaacctgaaagcagagaaaagtagaatgtacgtggtgaaa
ggatctacaagagagaaccactttcggggtctcatacaaaatattcatctgatttttgga
acttcagtagaggatgtgttacgtaacaaaggatgccagaagagccaatcagctgaagtg
aacaccatcaatgagagcacagaaatccttcatctcaccccttcggtcatgacagaatac
attggggacaatactgagaagaagccagaattctgtgatcgctcttgtgaagagcttggg
tctatgtttactgaactcactgggttgcgcattgttgtcaatggcttaactgaaaagtta
gaaaaagtgtctgaagtgaatgaaaaaattgtgtcagaattgcttggcccaaacaagaca
ctgaagaaccaatcagcatgttggcaagatggtcgtgaatttgtaaacaattcacactgg
gtggtggacagctgtacaaaatgtcactgtcagaactctaaaacagtatgcaataaaatc
acatgccccccggtgcactgtgtcagcccagctttcattgatggcgaatgttgtcctgtc
tgctcccactctgatgacagtgaagaaggctggtccccttggtctgagtggacagaatgc
tctgtcacatgtggatctggaacccaacagcgggggaggtcatgtgatgttaccagtaac
acttgtcgaggcccctccattcaaaccaggacgtgttctcttggcaaatgtgacaatcgt
atacgtcaagatgggggctggagccactggtctccttggtcttcctgttctgtgacctgt
ggagtaggcaacataactcgcatacgtctctgcaactcccctatcccacagatgggtggg
aaaggctgcaaaggaagtgggcgtgaaaccaaagaatgtgaaggaccaccatgtccagtt
aatggtcgatggagcccttggtctccctggtctgcttgtacagttacctgtggaggaggt
attcatgagagatctcgtctctgtaatagcccagaacctcagtatggaggaaagccctgt
gtgggagatgttatacagcgagatatgtgcaataaacaggattgcccaatagatggatgc
ttgtcaaatccttgcttcccaggagcagactgcaacagctaccctgatggttcttggtct
tgcggtgcatgtcctgctggatatcttggaaatggaacgttttgcgaggacctcaatgag
tgtgcggtagtgccagatgtttgctttaagttaaatcagaaccaccgttgtgtaaacaca
aatccaggattccattgcttgccgtgccctccacgctacaaaggaactcagccatatggg
gtaggcctggaggctgccagagcggaaaaacaagtatgtgaaccagccaatccttgcaaa
gacaaaacacacaactgccacaggtccgcagagtgcatctatttggggcatttcagtgac
cccatgtacaagtgtgaatgtaggacgggctatgctggtgatgggttcatttgtggtgaa
gactctgacctggatggatggcccaataataacctggtctgtgctgcaaatgctacttat
cactgcatgaaggataattgtccccttttacctaattctggacaagaagactttgataaa
gatgggaaaggtgatgcctgtgatgaagatgatgacaatgatggtgtagaggatgataaa
gacaactgtccccttctttttaatccccgtcaatttgactatgataaagatgaagttggt
gaccgttgtgataactgcccctatgtgcacaatcctgctcaaattgacactgataataat
ggagagggtgatgcatgtgcagtggatattgatggagatgatgttttcaatgcacgagat
aactgcccatatgtctacaacactgatcaaatagatacagatggggatggagttggtgat
caatgtgacaactgtcctctggttcacaatcctgaacagactgatgtcgataatgatctt
gttggtgaccagtgtgacaacaatgaggacattgatgaagatggtcaccagaacaacaaa
gacaactgtccgtacatttctaatgccaatcaggcagaccatgataaggatgggaaagga
gatgcttgtgatcctgatgatgacaatgatggtattccagatgacagagacaattgccgt
ctcacatttaacccggaccagaaggactctgacggtgatggccgaggtgacatctgcaaa
gatgattttgacaatgacaaagtgccagatatttatgatgtgtgtcctgaaaatgatgcc
attagtgaaactgatttcagaaagttccagatggtgcctctggaccctaaaggaacaaca
cagattgacccaaattgggtcattcgtcatcagggcaaagaacttgtacagacggctaac
tcagaccctggcatcgctgttggttatgatgaattcagttctgttgacttcagtggtaca
ttttatgtcaacacagaccgggatgatgattatgctggatttgtttttgcttaccagtct
agcagtcgcttctatgtcctgatgtggaaacaagttactcagacctattgggaagacaag
cccactagggcttatggttactcaggagtatcacttaaagtagtgaactccacaactggc
actggtgaacacttgagaaatgctctttggcatactggaaatacagctggacaggtgcgt
acattgtggcacgaccccaagaatattggctggaaagattacactgcctacaggtggcat
ttgatccataggcctaaaacaggattgataaaggttttagtatatgaagggaagcaaatc
atggcagattctggagccatctatgacaagacctatgctggtgggaggttaggtctattt
gtcttttcacaagagatggtgtacttctctgacctcaagtatgaatgtagagatgcctga

DBGET integrated database retrieval system