KEGG   Anolis carolinensis (green anole): 100563590Help
Entry
100563590         CDS       T01608                                 

Gene name
usp36
Definition
ubiquitin specific peptidase 36
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1114 aa AA seqDB search
MPIVDKLKEALKPGRKDSADDVELGKLLAASAKKILLQRIEFEPASKSFSYQLESLKSKY
ILLNPKTENPSRHKGSEEGSNRKQGIEHVLGGDGVPAPQKVLFPVERLSLKWERVYRVGA
GLHNLGNTCFLNSTLQCLTYTPPLANYLLSKEHSRSCHQGGFCMMCIMQNHMIQAFANSG
NAIKPVSFIRDLKKIARHFRFGSQEDAHEFLRYTIDAMQKACLNGYTKLDRQTQATTLVH
QIFGGYLRSRVKCSMCKSVSDTYDPFLDVALEIRQAANIVRALELFVKADVLSGENAYMC
AKCKKKVPASKRFTIHRASNVLTISLKRFANFSGGKITKDVGYPEFLNIRPYMSQSSGDP
VMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSSNIKVVLNQQAYVLFYLR
IPSTRKNPEGPISKSSVSNRTNIVSDHMKKSMTNGSLSSPQMNKKQDAAQVKKVSSDTEE
AGVPISRSSFTTHSKLQNGTFSSPSHSPLPKFIPSIGFSSPKLPSKPAFLEDLSKRSKKQ
SVLPLKTSQDFNENGSARVDMGKQNSWGDKRLSSSSSHLAGPPRGDPEAKMRDGSTELPS
KDSSSLTSSLSPSPSSSSSSSSSPAHNSLKGLPQSTVGINGYCSSQETDCASGKHGSEDS
KFAKLKSPLLANVNNLELGSTMSPPPAKKLALSARKVNTLQKVSGSEHRAPPHSPPAATN
TIHPVCAAALGCPRVLSPTSKSSTPLQLADSTSVDVAPSSSFKPRCLSAAAPLSPPAVPT
QAPSHSHPDKGPFLDRSRKMKRKHSAPGEEQDNHFSSNVTNFNAEGTQLLSPPRKKRQLK
ENGSVLSSSVRKSDVAAAKKEKEGETYLDARTPNSVRKKKKRLHQKEEDCMPLLSPVNSC
SSQREGEVSGEESCVKKKKKKKKKKKQNLSTDSDKGSYAEESEHRKHKKRESQGDPVPVM
SSPQEKRHGNGISSARLSPSVALACSSQLRHEDNCSLNILSPKKEVIQHKHGQSDVLQEL
LKDSLDKAYGKRVLTWEGEVSAVSQDAMQDTAWSRSQTVMDDWDEEFDSGKVKKIKKLKR
ERRKNFNAFQKLQSRRNFWAETHPAKLASLSYRL
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atgcctatagtggacaaactgaaggaagccctaaagcctgggcgaaaggactctgctgat
gatgtggagctgggcaagctgttggcggcttcggccaagaagattttgctgcaaaggatt
gagtttgaaccagcctcaaaaagcttctcctaccagctagagagtctgaaaagcaagtac
attctactgaacccgaagacagaaaaccccagtcggcacaagggctctgaagagggatcc
aaccgaaagcaaggcattgagcatgtcctgggaggcgatggagtgccagccccacagaaa
gtcctcttccccgtggagcgtctctccctgaaatgggagcgggtatatcgtgtcggagct
ggtctccacaacctgggcaatacttgcttcctgaactccactttgcagtgtctgacctac
actccccctctcgccaattatctgctttccaaggagcacagccgcagctgccaccaggga
ggcttttgcatgatgtgtattatgcagaatcacatgatacaggcattcgctaacagtggc
aatgccatcaagccagtgtccttcatcagggatcttaaaaagattgctcgtcatttccgt
tttggcagtcaggaggatgctcatgagttcttgcgctacaccattgatgccatgcagaag
gcctgcctcaatggctataccaagttggatcgccagactcaggctaccacattggttcat
cagatctttggtggctacctccgatctcgtgtgaagtgctccatgtgtaaaagtgtttca
gacacctatgaccccttcctggacgtggctttggagatcaggcaggctgccaacattgtc
cgggcacttgaattatttgtaaaggcagatgtgctgagtggggagaatgcctacatgtgt
gccaagtgcaagaagaaagtgccagccagcaagcgctttactatccaccgagcatccaac
gtcctcacaatctctctcaaacgctttgccaacttcagtggaggcaagatcaccaaggac
gtaggttaccctgaattcctgaacatccgtccttatatgtcacagagcagtggtgaccct
gtcatgtatggcctctatgctgtgcttgtgcattcaggatatagctgccatgctgggcat
tactactgctatgtcaaggcaagtaatgggcagtggtaccagatgaatgactccctagta
cattcaagcaacatcaaagttgttctcaaccaacaagcttatgtgcttttctacctaagg
atcccaagtacaaggaagaatcctgaagggcctatctccaaaagctctgtttccaatcga
acaaatatagtctctgaccatatgaagaaaagcatgaccaatggttccttatcttcacca
cagatgaacaaaaaacaagatgcagctcaggtcaagaaggtatcttcagataccgaggaa
gctggtgtccctatttcccgcagttcttttactactcactccaaacttcagaatgggacc
ttttcttctccttctcattctcctcttcccaagttcatacctagcattggattctcatct
cctaagctccccagcaagccagccttcttggaggacttaagcaagagatccaagaagcag
tccgtgctgcccctcaaaacatctcaggactttaatgagaatggcagtgctagggtcgat
atgggcaagcagaactcttggggagacaagaggttgtcatcatcatcttcacatctggca
ggtcctccgagaggagatcctgaggccaaaatgcgtgatggaagcacagagctaccaagt
aaggactcgtcgtctttgacctcttctttgtcgccatcaccatcttctagcagctcctct
tcgtctagccctgcacataactccctcaagggacttccacagtcaacagtaggcatcaat
ggctactgttcttctcaggaaacagactgtgcctctgggaaacatggttctgaggactcc
aagtttgccaagctaaagtcaccgttgctggctaatgtgaacaatctggagctgggaagt
accatgtcacctccacctgcaaagaaattggcactttctgccagaaaggtcaacacactg
cagaaagtgagcggcagtgagcatcgagcgccgccccactccccaccagctgccacaaat
accatccaccctgtttgtgccgctgcgcttggctgtcccagggtgctctcacctacttcc
aaatcttcaacacctctgcaactagctgacagcacctctgttgacgtcgcaccctcatcc
agcttcaagccacgctgcctctctgctgctgcccctttgtcaccacctgctgtgcccaca
caggccccgagccactcccacccagacaagggacctttccttgacaggtcaaggaagatg
aaaaggaagcatagtgccccaggggaagaacaagataaccatttcagctcaaatgtgaca
aacttcaatgcagagggtacccagctgctcagtcctcccaggaaaaagaggcagctgaag
gaaaatggcagtgttttgtcctcttccgttaggaagagtgacgtggcagcagccaagaag
gaaaaagagggggaaacatatttggatgccaggacaccaaattctgttcggaagaagaag
aaaaggcttcaccagaaggaggaagactgcatgccactactgtcccctgtgaacagctgc
tcttcacagcgtgagggagaagtatcgggagaagagtcctgtgtcaagaagaagaaaaag
aagaaaaagaaaaagaagcagaacttgtcaacagactcagacaaaggcagctatgctgaa
gagagcgagcatcggaagcacaagaagagggagagccagggggatccggtgcctgtgatg
agcagcccccaagaaaaacgacacgggaacggcatctcttcagcaagactcagcccttca
gtagccttggcttgtagcagccagcttagacatgaggacaactgctccttgaacatcctg
agtccaaagaaggaggtgattcaacacaagcatgggcagtctgatgtactccaggagctg
ctgaaggattctttggataaggcgtatggaaagcgagtgctgacgtgggaaggtgaagtg
tctgctgttagccaggatgctatgcaagatactgcatggtccaggagccagacagtcatg
gacgactgggatgaagagtttgacagtgggaaggtaaagaaaattaagaaactcaaacgt
gagcggagaaaaaacttcaatgccttccagaaattgcaaagccggcgtaacttctgggct
gagacacatccagctaaattggctagcctgagctaccggctctga

DBGET integrated database retrieval system