KEGG   Anolis carolinensis (green anole): 100563592Help
Entry
100563592         CDS       T01608                                 

Definition
phospholipase B1, membrane-associated-like
Orthology
K14621  
phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100563592
   00565 Ether lipid metabolism
    100563592
   00590 Arachidonic acid metabolism
    100563592
   00591 Linoleic acid metabolism
    100563592
   00592 alpha-Linolenic acid metabolism
    100563592
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100563592
    3.1.1.5  lysophospholipase
     100563592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 368 aa AA seqDB search
MKNDPKINFQEDWKVITIFIGGNDLCDHCKDLVRYSPENFTSNTQTALDILHKEVPRAFV
NLVTILHITVLRELYQEKKVYCPRLITRNLCSCVLNPADNSDEIDILESFNKRYQEQTHN
LINSGRYDTREDFTVVVQPLFEEAEMPMTPEGLPDSSYFAPDCFHFQQKAHSQAARALWN
NMLEPIGKKTKLRSFVTEINLVCPNQTQPYLMTYRNSNYTYQNEKTEDYGSQLLCDDRMP
SINNPTSVHSLKPADVQVIAALGDSLTAGNGVGSKPNDILDMITQYRGLSWSIGGDASLQ
SVTTLPNILREFNTHLTGYSTNKGGPSDMNAFLNQAVPGAKAEYVLLHTNLYTTSMGLTD
IGVFKAFP
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgatcctaaaataaatttccaagaagattggaaggtcataacgattttcata
ggaggaaatgacttgtgtgatcattgtaaggatcttgtacgttattctcctgaaaacttc
acaagcaatacacagacagctttggatatacttcataaagaggttcctcgagcatttgtg
aacctggtgacaattcttcatattacagttctaagggaactttatcaggagaaaaaggtt
tactgcccacgactgattacaaggaatctgtgttcttgtgttttgaaccctgctgataat
tccgatgaaattgatatattggagtccttcaacaaaagataccaggagcaaacccacaac
ttaatcaatagtggaagatatgacacaagagaagattttactgtggttgtacagccactt
tttgaagaagcagaaatgccaatgactccggaaggattgccagattcttcatattttgcc
ccagactgcttccattttcaacagaaggcgcactcccaggctgcccgtgctctatggaac
aacatgctggaacctattgggaaaaaaacaaaactgcgatcatttgtaactgagataaac
cttgtgtgtccaaatcagactcagccatatttgatgacatacagaaacagcaactatact
taccagaacgagaagactgaagattacggaagccagttgctatgtgatgatagaatgcca
tccatcaacaatcctacttcagttcacagcctgaaaccagctgatgtgcaagtaatagct
gccttaggggactccttgactgctggtaatggtgttggctcaaaaccaaatgacatattg
gatatgattacacagtatcgtggtctgtcttggagcattggaggagatgcttcattacag
agtgtcacaactttgcctaacatcttgcgggagttcaacacccacctcactggttactca
actaacaagggtggcccaagtgacatgaatgcctttcttaatcaagcagttccaggagca
aaggcggagtatgtccttctgcacactaatttgtatactacctcaatgggacttactgat
attggggtcttcaaggcattcccttaa

DBGET integrated database retrieval system