KEGG   Anolis carolinensis (green anole): 100563614Help
Entry
100563614         CDS       T01608                                 

Definition
beta,beta-carotene 15,15'-monooxygenase-like
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Retinol metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:acs00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
C
AA seq 536 aa AA seqDB search
MEAIFGRNIEEHPEPLQARVEGEIPSWMEGILLRNGPGMHTIGESRYNHWFDGMALLHSF
TIKNGEVFYRSKYLRSDTYNCNIEANRIVVSEFGTMAYPDPCKNIFSKAFCYLSHTIPEF
TDNCLINIMKNGDDFYATSEVNFIRKINPQTLETLEKVDYTKYVAINLATSHPHYDSAGN
VLNMGTSIVDKGKTKYVIFKIPSTVPVSEKKKKKRLKHLEVMCTIPSRSLLHPSYYHSFG
MSENYIIFVEQPFKLDILKMATAYIRGVNWASCLTFHKDDKTWIHLIDRRTKKVISTKYY
ADAMVLFHHVNAYEEDDHVIVDIISYTDNSLYHMFYLKNLDSQFESSVKLTSNPSCKRFV
LPLQCDQDSEIGSNLVQLPSTTATALKEKDGSIYCQPETLCQGIELPRINYDYNGKKYRY
IFATEVKWLPVPTQIVKFDILTKQRLQWEEEHCWPAEPVFVPSPNAKEEDEGIILSTIVT
SDSQKLPFLLILDAKTFKEIARATVDVKLHLDLHGSFIPQKDLKTEHEGDLDREQE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggaagccattttcggcaggaacatcgaggagcacccggagcccctccaggcccgagtg
gaaggagaaatcccaagctggatggaggggattcttctccgcaacggtcctgggatgcac
acaattggagaaagcagatacaaccactggtttgatggcatggctctgttgcacagtttt
acaataaaaaatggggaagttttctatcgaagcaaatacctccgtagcgacacctataat
tgtaatattgaggcaaacagaattgtggtgtccgaatttggaacaatggcttacccggat
ccatgcaaaaacatattttccaaggccttctgctatctgtcccacacgatccctgagttc
acagacaactgcctcatcaacatcatgaaaaatggggatgacttctacgctacaagcgag
gtcaacttcattaggaagatcaacccacagactctggaaacactggaaaaggttgactac
acgaagtatgtagccatcaacctggcaacatcccatccccattatgacagtgctggaaat
gttcttaacatgggaacctccattgtggacaagggaaagacaaaatatgtgattttcaag
ataccttctacagtgccagtcagtgaaaagaagaaaaagaaacgcctgaaacacctagaa
gtcatgtgtaccatcccctcccgctctctcttgcatcccagctattatcacagctttggc
atgtcggaaaactacatcatctttgtggaacagccattcaagctggatatactcaagatg
gcaactgcctatatcagaggggtgaactgggcctcttgcctcaccttccataaagatgac
aagacctggatccacctcatcgacaggagaaccaaaaaagtcatatccaccaagtattac
gcagacgccatggtcctcttccaccatgtgaatgcctatgaggaagatgaccacgtgatt
gtggacatcatctcctatacggacaacagcctgtaccatatgttctatttgaagaacttg
gacagtcagtttgagagcagcgtgaaactgacttccaatccgtcctgcaagaggtttgtg
cttcctctgcaatgtgaccaggactcagagataggctcgaatttggtccagcttccatca
accactgcaactgccctgaaggaaaaagatggtagcatctattgccagcctgagacatta
tgtcaaggaatagaactgcctcgtatcaactatgattacaatgggaaaaagtacaggtat
atctttgctaccgaggttaaatggctcccagttcccacacagatagttaaatttgacatt
ttgacaaagcagaggcttcagtgggaggaagaacactgttggccggctgaaccagtcttc
gttcctagtcctaatgccaaagaagaagatgaaggtatcatcctttcaaccatcgtgaca
tcagattctcaaaaactgcctttcctgctgatactggatgccaaaacgttcaaagaaatt
gcccgagccactgttgatgtgaagctccacttggacttacatggctccttcatcccgcag
aaggatttgaaaacagagcatgagggagatttggacagagaacaagagtaa

DBGET integrated database retrieval system