KEGG   Anolis carolinensis (green anole): 100563637Help
Entry
100563637         CDS       T01608                                 

Gene name
apoe
Definition
(RefSeq) apolipoprotein E
  KO
K08760  apolipoprotein A-IV
Organism
acs  Anolis carolinensis (green anole)
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein Baculo_PEP_C ApoLp-III YtxH DUF883 DUF445 Apo-CIII Exonuc_VII_L Prominin Bacillus_HBL DUF1664 SF-assemblin DUF1845 OmpH DUF4795 DUF4456 BshC dCache_2 DUF4455 AAA_13 WXG100 DUF3584 Herpes_UL6 REF DUF1690 CENP-F_leu_zip PHA_synth_III_E Collagen_mid PHA_gran_rgn HBM Muted Gp-FAR-1 BORCS6 FliT FUSC CHAD T2SSF DUF4085 Leu_zip FAM184 RRF Sec23_trunk Gp58 ZnuA DUF515 DUF1640 Fib_alpha PLC-beta_C
Motif
Other DBs
NCBI-GeneID: 100563637
NCBI-ProteinID: XP_003229179
Ensembl: ENSACAG00000025245
UniProt: H9GQY3
Position
Un
AA seq 252 aa AA seqDB search
MRFGTVFLALAVLTGSYASFLSDEPRRPRLEQIHDTIREYIDKISKSTSDNLQSIRNSEL
GREINARVSDSLASAQSYQAELQKHLPPVAQDLLQKIVADLKQVNEKVQPFAEDLNQKMQ
GGVSQLQERLAPFAEDLLEQAEQHTQSLRQALASGTEELKANLQRNVEDLQAQLGPLAED
MKGKIQQQVEDFRQGVEPLAQRLQGSLSEGLHRVRHNLHPYAEDLHQKLVPLAENLQGQL
SGLWSAFRERFQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcggcaccgttttcctcgctttggccgtcttgacagggtcgtacgcctctttc
ctgagcgacgagccccgccggccccgcttggagcagatccacgacaccatccgggaatac
atcgacaagatctccaaaagcacctccgacaacttgcaatccatccgcaactcggagctg
ggccgggagatcaatgcccgcgtctccgacagcctggccagtgcccagagctaccaggcc
gaactgcagaagcatctcccgccggtggcccaagacctgctgcagaagatcgttgccgac
ctgaagcaagtgaacgagaaggtccagcccttcgccgaggacctgaaccagaagatgcaa
ggcggggtgagccagctgcaggagcgcctggcgcccttcgcggaggacctcctggagcag
gcggagcagcacacgcagagcctgcgccaggccctggcctccggcaccgaggagctcaag
gccaacctccagcgcaacgtggaggacctccaggcccagctggggccgctggccgaggac
atgaagggcaagatccagcagcaggtggaggacttccggcagggcgtggagcccctggcc
cagcggctgcaggggagcctctccgaggggctgcaccgcgtccgccacaacctgcacccc
tacgccgaggacctccaccagaagctggtcccgctggccgagaacctccaagggcagctc
agcggcctctggagtgccttccgggagaggttccagtga

DBGET integrated database retrieval system