KEGG   Anolis carolinensis (green anole): 100563637Help
Entry
100563637         CDS       T01608                                 

Definition
apolipoprotein A-IV-like
Orthology
K08760  
apolipoprotein A-IV
Organism
acs  Anolis carolinensis (green anole)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 244 aa AA seqDB search
FHALLAGSYASFLSDEPRRPRLEQIHDTIREYIDKISKSTSDNLQSIRNSELGREINARV
SDSLASAQSYQAELQKHLPPVAQDLLQKIVADLKQVNEKVQPFAEDLNQKMQGGVSQLQE
RLAPFAEDLLEQAEQHTQSLRQALASGTEELKANLQRNVEDLQAQLGPLAEDMKGKIQQQ
VEDFRQGVEPLAQRLQGSLSEGLHRVRHNLHPYAEDLHQKLVPLAENLQGQLSGLWSAFR
ERFQ
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
ttccacgcccttctcgcagggtcgtacgcctctttcctgagcgacgagccccgccggccc
cgcttggagcagatccacgacaccatccgggaatacatcgacaagatctccaaaagcacc
tccgacaacttgcaatccatccgcaactcggagctgggccgggagatcaatgcccgcgtc
tccgacagcctggccagtgcccagagctaccaggccgaactgcagaagcatctcccgccg
gtggcccaagacctgctgcagaagatcgttgccgacctgaagcaagtgaacgagaaggtc
cagcccttcgccgaggacctgaaccagaagatgcaaggcggggtgagccagctgcaggag
cgcctggcgcccttcgcggaggacctcctggagcaggcggagcagcacacgcagagcctg
cgccaggccctggcctccggcaccgaggagctcaaggccaacctccagcgcaacgtggag
gacctccaggcccagctggggccgctggccgaggacatgaagggcaagatccagcagcag
gtggaggacttccggcagggcgtggagcccctggcccagcggctgcaggggagcctctcc
gaggggctgcaccgcgtccgccacaacctgcacccctacgccgaggacctccaccagaag
ctggtcccgctggccgagaacctccaagggcagctcagcggcctctggagtgccttccgg
gagaggttccagtga

DBGET integrated database retrieval system