KEGG   Anolis carolinensis (green anole): 100563715Help
Entry
100563715         CDS       T01608                                 

Definition
thrombospondin-4-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
acs  Anolis carolinensis (green anole)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100563715
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100563715
  Cellular commiunity
   04510 Focal adhesion
    100563715
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100563715
  Exosomal proteins of colorectal cancer cells
   100563715
  Exosomal proteins of bladder cancer cells
   100563715
Heparan sulfate/heparin binding proteins [BR:acs00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100563715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 921 aa AA seqDB search
MNKRKAAFLLLQVALQLCPGFSTPPAAPQVFDLLSTPNQKLVKTFLQQALSDPTLNEVYV
LSTFKLQPKSTAVIFGLYSPTENRKYFEFTVMGRVNKVSLRYLRNDGKLHAVIFNNVPLA
DGKRHTVLLRLSGLQRGHSKAELYVDCAQLDSTQELSKAFSGLSQSSEPVELRTLQRKVQ
DALEELKLVIRGSLSQVAGLQDCFLPQIEPAVKETTFLRNTIAECQACGLGAGNFPTPPP
LPPKPKCEVSTCFRGVRCTDTADGFQCGPCPEGFTGNGIVCTDIDECRYNPCFPGVRCVN
MAPGFRCEACPPGYTGQIIQSVGINSAKNNKQVCMDIDECQKNGNGGCVANSLCINTVGS
YRCGACRPGFIGDQVRGCRAEQSCKNLALNPCSIHAQCTEVRQGDISCICGIGWAGDGFV
CGKDVDIDGYPDEELPCSLETCRRDNCKYVPNSGQEDADGDGAGDSCDDDADGDGIPNEQ
DNCVLASNVNQRNSDQDIFGDACDNCRMALNNDQRDTDGDGKGDACDDDMDGDGIKNVLD
NCQRVPNPEQKDRDNDGVGDACDSCPDISNPNQSDVDNDLVGDSCDTNQDSDGDGHQDST
DNCPTVINSSQLDTDKDGIGDECDDDDDNDGIPDFVPPGPDNCRLVPNPGQEDDNSDGVG
DICEADFDHDTVIDRIDVCPHNAEITLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIV
QTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQTEQTY
WQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTNDQVRLLWKDPRNVGWKDKVS
YRWFLQHRPQVGYIRARFYEGSDLVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRC
NDTIPEDFQEFQAQQYTVGDI
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcgcaaagccgccttcttgctcttgcaggtcgccttgcagctctgcccgggc
ttctccactccgcccgcagcccctcaagtttttgatcttctttctacacccaaccagaag
ctagtaaaaactttcctgcaacaggcactgtccgatcctacattgaatgaagtatatgtg
ctctcgacgttcaaactgcaacccaaaagcacagctgtgatatttgggctatattcccct
actgaaaacagaaaatactttgaatttacagtaatgggacgggtgaataaagtttccctc
agatatttacggaacgatgggaaattacatgctgtgatcttcaacaatgttccattagct
gatgggaaacggcacacggttctcctccggcttagtggcctccaacgtggccacagcaaa
gcagaattgtatgtggactgtgcacagctagattccactcaagaactttcgaaagccttc
tcagggttgtctcaaagctcagaacctgtggaattacggacactgcagagaaaagtgcag
gatgctttggaagaattgaagctagtaataagagggtcactatctcaagtggcaggcctg
caagattgctttcttccacaaattgaaccagcagttaaagagacaacgtttctgagaaat
acaatagcagaatgccaggcatgtggacttggagctggaaactttcccactcctccaccg
ctgcctcctaagcccaagtgtgaagtcagcacttgcttccgaggggtgcgatgcacagac
acagcagatgggtttcagtgtggaccttgtcccgaagggttcactggaaatggaattgtt
tgcactgatattgatgagtgtcgatataatccatgcttcccgggagtgagatgtgtgaac
atggctcctggtttccgatgtgaagcctgcccaccgggatacactgggcagattattcaa
agtgtaggaataaactctgcaaaaaataacaaacaggtttgcatggacatagatgaatgt
cagaagaatggaaatggaggttgtgttgcaaattccctctgtataaataccgtggggtcc
tatcgctgtggagcttgcaggccgggatttattggagaccaagtcaggggttgcagagct
gagcaaagctgtaaaaatctggccctaaacccttgcagtatccatgcccaatgtactgaa
gtaaggcaaggagacatctcatgtatttgtggcatcggctgggccggtgatggctttgtg
tgtggaaaagatgttgatattgatggctatcctgatgaagaactcccctgctcacttgaa
acttgcagaagggacaactgcaaatatgttccaaactctggacaagaagatgcagatgga
gatggagcaggagattcttgtgatgatgatgcagatggagatggtattccaaacgaacag
gataattgtgtgcttgcttctaatgttaaccagagaaatagtgaccaagatatctttggt
gatgcttgtgacaattgtcgcatggccttgaacaatgatcagagagacactgatggagat
ggcaaaggagatgcttgtgatgatgacatggatggagatggcattaagaatgttttggat
aactgtcaaagagttcccaacccagaacagaaggacagagataatgatggcgttggtgat
gcctgcgatagttgcccagatattagcaaccctaatcagtcagatgttgataatgacctt
gtaggggattcctgtgacaccaaccaagacagtgatggggatgggcatcaggacagcacg
gacaactgccctacggtcattaacagctcccagctagatacagataaagatgggataggt
gatgaatgtgatgatgatgatgacaatgatgggattccagattttgtcccacctggtcca
gataattgccggctggttcctaacccagggcaggaagatgacaacagtgatggagtaggt
gacatctgtgaagcagattttgatcatgacactgtgatcgaccggattgatgtctgtccc
cacaatgcagagatcaccctgactgatttccgagcttatcagacagttgtccttgatcca
gaaggtgatgctcagattgatccaaactgggtggttctgaaccagggtatggagattgta
caaaccatgaacagtgatcctgggcttgctgtaggttatacagctttcaatggagttgac
tttgaaggcactttccatgtaaacacggtgacagacgatgactatgctggcttcatcttt
ggttaccaagacagctccagtttttatgtagtgatgtggaaacagactgagcagacgtat
tggcaagcaactccattcagagctgttgcagagcctggaattcaactcaaggctgtcaaa
tcaaagaccgggcctggagaacaccttagaaactccctttggcacactggggacactaat
gaccaagtcagattattgtggaaagaccctcgaaatgttggctggaaagataaagtttcc
taccgctggttcctccagcacagaccccaggttggatatattagggcaaggttttatgaa
ggctctgacctggtggcagactctggagtgaccatagacacgaccatgcgtggagggaga
ctcggcgttttctgcttctctcaggaaaacattatttggtcgaatctgaagtatcgttgc
aatgataccatcccagaggacttccaggaatttcaggctcaacagtatacagttggagat
atttaa

DBGET integrated database retrieval system