KEGG   Anolis carolinensis (green anole): 100563731Help
Entry
100563731         CDS       T01608                                 

Gene name
mapk11
Definition
mitogen-activated protein kinase 11
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:acs04010]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:acs04370]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:acs04068]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:acs04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:acs04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:acs04622]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:acs04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:acs04914]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:acs04261]
Human Diseases; Infectious diseases; Salmonella infection [PATH:acs05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 361 aa AA seqDB search
MSERGGFYKQELNKTVWEVPLRYQQLTPVGSGAYGSVCSACDTKTRQKVAVKKLSRPFQS
LIHARRTYRELRLLKHMKHENVIGLLDVFTPATSIENFNEVYLVTNLMGADLNNIVKCQK
LTDDHIQFLIYQLLRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQTDDEMTG
YVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLKGKALFPGNDYIDQLKRIMEVVGT
PSSELLKKISSEHARKYIESLPHMPQQDLKAVFRGANPLAVDLLEKMLILDSDKRITASE
ALAHAYFVQYHDPDDEPEAELYDESIENKERVIDEWKELTYGEVISFKPPDLKMDSLEIE
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcgcggcggcttctacaagcaagagctgaacaagacggtgtgggaggtgccc
ctgcgctaccagcagctcaccccggtgggctccggcgcctacggctccgtctgctcagca
tgtgataccaaaacaagacagaaggtggcagtcaaaaagctttcgaggcctttccagtcc
cttattcatgccagaaggacctaccgggagcttagattactcaagcatatgaaacatgaa
aacgttatagggttactagatgtttttacacctgcaacatcaatagaaaattttaacgaa
gtatatcttgtcacaaatttaatgggtgctgacctcaataatattgtgaagtgccaaaag
ttgacagatgaccacatacaatttcttatatatcagctactacgagggcttaagtatatt
cattcagctggaatcattcaccgggacctgaagccgagtaacctagctgtaaatgaagac
tgtgaattaaggatattagactttggcttggcccgacaaactgatgatgaaatgacaggt
tacgtagcaacacggtggtacagagcaccagaaatcatgttaaactggatgcattacaat
caaacagttgacatttggtcggttgggtgcatcatggcagagctgctgaaagggaaagcc
ctgtttcctggaaacgactatattgatcagctaaaacgaataatggaagtggttggcaca
ccgagttctgaacttctcaagaaaatctcatcagaacacgccagaaagtatatagaatct
ctgccccatatgccacaacaggatttgaaagcagtgtttcgtggcgctaacccactggct
gtggatcttcttgaaaaaatgcttatactggacagtgacaaaagaataactgcttcagaa
gcacttgcccatgcttactttgtacagtatcatgaccctgatgacgaacctgaggcagag
ctgtatgatgaatcaatagagaataaagaacgggttatagatgagtggaaagagcttaca
tatggagaagtgatcagctttaaaccgcccgatttaaagatggacagccttgaaattgag
caataa

DBGET integrated database retrieval system