KEGG   Anolis carolinensis (green anole): 100563801Help
Entry
100563801         CDS       T01608                                 

Gene name
josd1
Definition
Josephin domain containing 1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100563801 (josd1)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C86
   100563801 (josd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 202 aa AA seqDB search
MSCVPWKGDKTKSEAPETPQQTPVRIYHEKQRRELCALHALNNVFQDGNAFTRDTLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVNVIALSNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGTYYNLDSKLKVPEWIGGETELRKFLRHQLRGK
NCELLLVVPEEVEAHQSWRADA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtgtgccatggaaaggtgacaaaaccaaatctgaagcgccggaaacaccacaa
caaacaccagtgcgtatttatcacgaaaaacaacgtagggagctgtgtgctctccatgct
ctcaataatgtcttccaggatggcaatgcctttacgcgagatacattgcaggaaattttc
cagaggttgtctcccaacactatggtgacaccacacaagaagagcatgttgggaaatggg
aactatgacgtgaatgtcatcatggcagctcttcagaccaaaggttatgaagccgtttgg
tgggataagcgcagggatgttaatgtaattgccctctctaatgtgatgggcttcattatg
aatctcccctcaagcctctgttggggtccactgaaacttcctctaaaacggcaacattgg
atctgtgtccgcgaagtgggaggtacctactacaatcttgactctaaactcaaggtgcct
gaatggattggtggtgaaacagagctcaggaagtttttgaggcatcagttacgaggaaag
aactgtgaacttctattggtggtgcctgaggaggtagaagcacatcagagttggagagct
gatgcatga

DBGET integrated database retrieval system