KEGG   Anolis carolinensis (green anole): 100563917Help
Entry
100563917         CDS       T01608                                 

Gene name
usp13
Definition
ubiquitin specific peptidase 13 (isopeptidase T-3)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100563917 (usp13)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100563917 (usp13)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100563917 (usp13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 939 aa AA seqDB search
MCRVHILSPPPLPRGPGGGLGGRGWSLCASFWAAAAPSALPPSPAGLKIASLLLLLLVRP
GGLSVCLPVCLSGAMERAALLGSGREAGSAVAMAGDVGELLVPYMPTVRVPKTGDRVYKA
ECAFSYDSPDSEGGLYVCMNTFLGFGREHVERHYRKTGQCVYMHLKRHVKEKVTGASGGA
LPKRRNTKLFLDLECNGDLNNDDYEYEDEAKLVIFPDHYEIPLPNIEELPALVTIACDAV
LSAKSPYRKQDPDSWEEELQVSKHANILVQMDNGVRIPPSGWKCSKCDLRENLWLNLTDG
SILCGKWFFDGSGGNGHALEHYKEMGYPLAVKLGTITPDGADVYSFDEEEAVLDPHIAKH
LAHFGIDMLQMHVIENGLRDNDIKPRVSEWEVIQESGMKLKPMFGPGYTGLKNLGNSCYV
NSVLQALFNIPEFQRAYVGNLPRIFDYSPLDPTQDFNTQMAKLGHGLLSGQYSKPPMKSE
IIEQVMKEEQKPQHNGISPRMFKALVSKGHPEFSSNRQQDAHEFFLHLINLIERNHIGSE
NPSDVFRFLVEERTQCCQSRKVRYTERVDYLMQLPVAMEAASNKDELIAYELKRREAEAA
RRPPPELVRAKIPFSACLQAFSEPDNVEDFWSSALQAKSAGVKTSRFASFPEYLVVQIKK
FTFGLDWIPKKLDVSIDMPELLDINHLRATGLQPGEEELPDISPPIIIPEDPKDGTTNHF
MESPDIDESSVMQLAEMGFPLEACRKAVYYTGNMGAEVAFNWIIAHMEEPDFAEPLLIPG
YAGAAFPGADKPGFAGLDNQPPEEMVAIIASMGFQRNIALRALRATNNNLEHALDWIFSH
PEPEEANEASSEAMDIENHVNANLLAESDPEGPRVKDGSGRYELFGFISHMGTSTMSGHY
VCHLKKEGRWVIYNDLKVCASERPPRELGYIYFYRRISS
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagagtgcatatcctctctcccccccccctccctcgggggccaggaggcgggctt
ggcgggcgtggctggagcctttgcgcttctttctgggcagctgcggctccctccgcgctc
cctccgtctcccgccgggttaaagatagcctccctcctcctcctccttctcgtccggcca
ggagggctctcggtctgcctgcctgtctgtctctctggggcgatggagcgggcggcgctg
ctgggctccgggcgggaggcgggctcggcggtggccatggcgggggacgtgggagagctc
ctcgtgccctacatgcccaccgtccgggtgcccaagaccggagaccgcgtctacaaggcc
gagtgcgccttctcctacgactcgccggattctgaaggagggctttatgtctgcatgaat
actttcctgggatttggaagggaacatgtagaaaggcattatcggaagacagggcagtgt
gtatacatgcatttgaaacggcacgtcaaggagaaggtaacaggggcatctggtggagct
ttaccaaaaaggagaaacaccaagctatttttagatctagagtgcaatggtgatttgaat
aatgatgactatgaatatgaggatgaagcaaagcttgtcatatttccagaccactatgaa
attcctttacccaatatagaagagttaccagcgctggtcacaatagcttgtgatgcagtc
cttagtgcgaaatcaccatacagaaagcaagatccagactcatgggaagaggaactccaa
gtctcaaaacatgcaaacattcttgtacagatggacaatggagtcaggatcccaccaagt
ggctggaaatgttcaaaatgtgacttgcgggagaatctttggctgaaccttacagacggg
tcaatactgtgtgggaaatggttcttcgatggcagcggaggaaatggacatgccctggaa
cactacaaggagatgggctatccattagcagtcaagcttggaacaattactccagatggt
gcagatgtttattcctttgatgaagaggaggcagttttggacccacacatagccaaacac
ttagcgcattttggtattgatatgctacaaatgcatgtaatagaaaacggcctgagagat
aatgatataaaacccagagtctccgaatgggaagtgatccaagaatctggcatgaagcta
aagccaatgtttggtcctgggtacactggcctgaaaaacctgggcaacagctgctatgtc
aacagtgtcctgcaggcgcttttcaacatccctgaatttcagagagcgtatgtgggaaat
cttccaagaatatttgattactcacctctggacccaacacaagatttcaatacacagatg
gctaaattgggacatggtctcctatcgggccagtattctaaaccgccaatgaaatctgag
atcattgaacaggtgatgaaagaagaacagaagcctcagcacaatggcatttctcctcgc
atgttcaaggctctggtcagcaaaggacaccccgaattctcctccaatcggcaacaagat
gcacatgagttcttcctacacctcataaatctaatagagaggaaccacattggttcagaa
aatcccagcgatgtcttccggttcttggtggaagagcgaacacagtgctgccagtctcgg
aaagtcagatacacggagagggtagactatctcatgcagttgcctgtggcaatggaggcg
gcctcaaacaaagatgaattgattgcttatgaactgaagaggagggaagccgaagctgca
aggaggccccctccagagcttgtacgtgccaagatcccctttagcgcttgccttcaggcc
ttttctgaaccagacaatgtagaagacttctggagcagtgctctgcaagccaagtctgct
ggagtgaaaacttctcgctttgcttcgtttcctgaatacctggtggtacagatcaagaag
tttactttcggccttgactggatacctaaaaaacttgatgtttccatagacatgccagag
ctcctggacatcaatcaccttcgtgctacaggccttcaaccaggagaagaagaacttcct
gatatctctccccccattatcattcctgaagaccccaaagatggcacgacgaaccatttc
atggagtcaccggacattgatgaatcctcagtgatgcagctagcagagatggggttccca
ctggaagcatgccgaaaggctgtctattatactggcaacatgggggcggaggtggctttc
aactggatcattgcacacatggaagaaccagattttgcagagccattactcatccctggc
tatgcgggagctgcttttcctggggcagataagccaggatttgctgggctggataaccag
cctccagaagagatggttgccatcattgcttctatgggcttccaacggaacatcgctctc
cgggcgcttcgggcaacaaataacaacttggaacatgcattagactggatcttcagccac
ccagagccagaggaggcaaatgaagccagttctgaagccatggacatagagaaccacgtg
aatgccaacctccttgcagaatctgacccagaggggcccagggtcaaagatgggtctgga
cgatatgaactttttgggttcatcagtcacatgggaacatcgacaatgagtggccattat
gtttgtcatctcaagaaggaagggaggtgggtgatctacaatgaccttaaagtctgtgcc
tctgaacgaccgcctagagagttgggatatatttacttctaccgcaggatatcaagttag

DBGET integrated database retrieval system