KEGG   Anolis carolinensis (green anole): 100563919Help
Entry
100563919         CDS       T01608                                 

Gene name
pfkl
Definition
phosphofructokinase, liver
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100563919 (pfkl)
   01230 Biosynthesis of amino acids
    100563919 (pfkl)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100563919 (pfkl)
   00030 Pentose phosphate pathway
    100563919 (pfkl)
   00051 Fructose and mannose metabolism
    100563919 (pfkl)
   00052 Galactose metabolism
    100563919 (pfkl)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100563919 (pfkl)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100563919 (pfkl)
Protein phosphatases and associated proteins [BR:acs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100563919 (pfkl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 787 aa AA seqDB search
MSGTGLGSPGLDLEKLRMAGAGLALAVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYE
GYEGLVEGGDNIKQADWLSVSNIIQLGGTIIGSARCKAFTTREGRLQAAYNLVQHGITNL
CVIGGDGSLTGANIFRTEWGGLLEELVSEGKITEEVSQTYSHLNIVGLVGSIDNDFCGTD
MTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPES
PPEDGWEDFMCERLGETRSRGSRLNIIIIAEGAIDRNGKAITSNYVKDLVVKRLGFDTRV
TVLGHVQRGGTPSAFDRVLSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQ
VTKDVQKAMDEKRFDEAIQLRGRSFENNWNIYKLLAHQKPAQEKSNFSIAILNVGAPAAG
MNAAVRSAVRVGICQGHTMYTVNDGFEGLSKGQIQEVGWHDVAGWLGRGGSMLGTKRTLP
KTCMEKIVENVRKFNIQALLVIGGFEAYEGVLQLVEARGQYDELCIIMCVIPATISNNVP
GTDFSLGCDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLSTVTGIAVGADAAY
VYEEPFTIHDLKANVEHLTDKMKTDIQRGLVLRNEKCHTHYTTEFLYNLYSSEGKGIFDC
RINVLGHLQQGGAPTPFDRNYSTKLGVKAVLWMSDKLKESYRKGRVFANSADSACVIGLR
RKTVSFSPVTELKKVTDFEHRLPKEQWWLNLRLMLKMLAHYQISLTEYVSGKIEHVTRRT
LSIEKGF
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggaccggcctgggttcgccggggctcgacctggagaagctgcggatggccggc
gctggcctggctctggctgtgctcaccagtggaggagacgcgcaaggtatgaatgctgct
gttcgagctgtgactcgtatggggatatatgttggagctaaagtgttcctgatctatgag
ggttacgaggggctggtggaaggtggtgataatatcaagcaggcagactggctgagtgtg
tccaacatcattcagttgggtggcaccatcattggcagtgctcgctgcaaagctttcacc
actcgggagggccggctccaggcagcctacaacctggtacagcacggcatcaccaacctg
tgtgtcattggaggggatgggagcctgacaggtgcaaatatcttccgcacagaatggggt
gggcttctggaggaactggtcagtgaagggaagatcacggaggaggtgtctcaaacatac
agtcatttaaacattgtgggcttggttggttccatcgacaatgacttctgtggcacagat
atgactattggcactgactctgccttgcaccgtatcatggaagtgattgatgcaatcacc
actaccgcccaaagtcatcaaaggacgtttgttctggaagtgatgggcaggcactgtgga
taccttgcattagtttcagctttggcctctggtgctgactggcttttcatccctgagtca
ccacctgaagatggttgggaggattttatgtgtgaaagactaggagagacacgaagcaga
ggatccaggctgaatattatcatcattgctgaaggtgccattgaccggaatgggaaagcc
atcacttctaactatgtgaaggatctcgttgtgaagcgccttggatttgacacccgtgtg
actgttcttggccatgtgcagcgtggggggaccccttcagcatttgaccgcgtcttgagc
agcaaaatgggcatggaagctgtgatggctttactggaagcaacaccagacactccagcc
tgtgtggtgagcctctctggaaaccagtctgtgcgcctgcccctgatggagtgtgtgcaa
gtgaccaaagatgtccagaaagcaatggatgagaaaagatttgacgaagcaatccagctc
agagggaggagctttgaaaataactggaacatttacaagcttcttgcacaccagaaaccg
gcacaggagaagagcaatttcagtattgcaattctcaatgtgggagcccctgcagcagga
atgaatgcagcagtccggtcagctgtacgtgttgggatttgccagggccacacaatgtat
acagtgaacgatggttttgaaggcttgagcaagggacagattcaagaggtgggatggcac
gatgttgccggatggctgggccgtggaggatctatgttaggaaccaaacgaactcttcca
aagacatgcatggaaaagattgttgaaaatgttcggaaatttaatatccaggcactattg
gttattggaggatttgaggcttatgagggagtactacagttggtggaagcacgtggacag
tatgatgagctttgtatcatcatgtgtgtcataccagctactatcagtaataatgttcct
ggcactgatttcagcctgggatgtgatacagctgtcaatgctgccatggagagctgtgac
cgtatcaagcagtctgcttcgggcacaaaacgacgcgtgttcattgtggaaactatgggg
ggttattgtggctacctgtcaacagtgactggcattgcagtgggagctgatgctgcttat
gtctatgaggagcctttcactattcatgacctaaaggcaaatgttgaacatttgactgac
aaaatgaaaacagacattcagagaggtctagtattgcgaaatgagaagtgccatacacac
tataccactgagtttctctacaacctttactcttcagaggggaaaggcatatttgattgc
aggatcaacgttttaggccatctccagcagggaggtgctccaactccttttgatcgcaat
tacagcacaaagctgggtgtgaaagcggtactgtggatgtcagacaagctgaaggaatcc
taccgtaaaggccgggtatttgccaattctgcagactctgcctgtgtaataggccttcgg
aggaagactgtgtcctttagccccgtgactgagcttaagaaagtaacagactttgagcat
aggctcccgaaggagcaatggtggctgaacctgcgtcttatgctgaagatgttggcccac
taccagatcagtctgactgaatatgtgtctgggaagatagagcatgttacccggcgcact
cttagtatcgagaagggattctag

DBGET integrated database retrieval system