KEGG   Anolis carolinensis (green anole): 100564029Help
Entry
100564029         CDS       T01608                                 

Definition
carboxypeptidase A1-like
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 418 aa AA seqDB search
MKVLLVLTGLLAVAFSVEIFEGHQVLRIFASDGFQMEKVKELEALEHLQLDFWRAPAHPE
IPVDVRVPFSSLQGVKVFLESNNIQYSIMIENVQKLVDEEKLFMSWTHFMPRSVENFNYA
SYHNIDEIYDFMDLLVSENPLVSKIQIGKSYEGRPINVLKFSTGGTKRPAIWIDTGIHSR
EWVTQASGIYFAKKILDTYGKDPSLTSILDNFDIFLEIVTNPDGFAFTQSKNRMWRKTRS
INAGSSCVGVDPNRNWDAGFGGAGASGSPCTETYRGPYANSEPEVKAIVDFVKSHGNIKA
FISIHSYSQLLLYPFGYTRTAAADKAELDAVAKKAVDALASLHGTKYKYGSIITTIYQAS
GGTIDWTYEQGIKYSYTFELRDTGRYGFLLPASQIIPTAEETWLGLMVIMEHTRDNPY
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcctcttggtgttgacgggtctcctggcggttgccttcagcgtcgagatcttt
gaaggtcaccaggtgttgaggatctttgcttccgatgggttccagatggagaaggtgaag
gagctggaagcgcttgaacatcttcagctggacttctggcgtgctcccgcccaccccgag
atcccagtcgatgtgcgggtcccattctccagcctccaaggggtcaaggtcttcctggag
tccaacaacatccaatactccatcatgattgagaacgttcagaaattagttgatgaggaa
aagctcttcatgtcatggacgcactttatgccccgatccgtggaaaacttcaactacgct
tcgtaccacaatatagatgaaatctacgatttcatggatcttctagtgagtgaaaatccc
ttggtcagcaaaatccagattggcaagagttacgaaggtcgtccaatcaatgtcttgaag
ttcagcaccggaggaaccaagcgcccagccatctggatcgacaccggcatccactctcgc
gaatgggtcactcaggccagtgggatctactttgcaaagaagatcctcgacacttatggc
aaagacccttcactgacttctattctggataattttgacatcttccttgaaattgtcacc
aatcccgatggatttgccttcactcagagcaagaaccgcatgtggcgcaagacgaggtca
atcaatgctgggtcgtcgtgcgttggagtagaccccaaccggaactgggatgcaggtttt
ggaggggccggtgccagtggcagcccttgcaccgaaacctaccgcgggccttatgccaac
tccgagccagaggtgaaagccattgttgactttgtgaagagccacggcaacattaaggcc
ttcatctccatccacagctactcccagctccttctttatccttttggatacacccgcacg
gctgcggcggataaggcggaacttgatgccgttgctaagaaggcagtcgatgctcttgct
tccctccatgggaccaaatacaaatacggtagcatcatcaccaccatctaccaagcaagt
ggaggaaccatcgattggacctacgagcagggtatcaagtactcctacacctttgagttg
agggacactggccgctacgggttcctgctgcctgccagccagatcatcccgacggctgaa
gagacttggctgggcctcatggtcatcatggaacacacccgggacaacccctattaa

DBGET integrated database retrieval system