KEGG   Anolis carolinensis (green anole): 100564029Help
Entry
100564029         CDS       T01608                                 

Definition
carboxypeptidase A1-like
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     100564029
Peptidases [BR:acs01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   100564029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 420 aa AA seqDB search
MKMKVLLVLTGLLAVAFSVEIFEGHQVLRIFASDGFQMEKVKELEALEHLQLDFWRAPAH
PEIPVDVRVPFSSLQGVKVFLESNNIQYSIMIENVQKLVDEEKLFMSWTHFMPRSVENFN
YASYHNIDEIYDFMDLLVSENPLVSKIQIGKSYEGRPINVLKFSTGGTKRPAIWIDTGIH
SREWVTQASGIYFAKKILDTYGKDPSLTSILDNFDIFLEIVTNPDGFAFTQSKNRMWRKT
RSINAGSSCVGVDPNRNWDAGFGGAGASGSPCTETYRGPYANSEPEVKAIVDFVKSHGNI
KAFISIHSYSQLLLYPFGYTRTAAADKAELDAVAKKAVDALASLHGTKYKYGSIITTIYQ
ASGGTIDWTYEQGIKYSYTFELRDTGRYGFLLPASQIIPTAEETWLGLMVIMEHTRDNPY
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaggtcctcttggtgttgacgggtctcctggcggttgccttcagcgtcgag
atctttgaaggtcaccaggtgttgaggatctttgcttccgatgggttccagatggagaag
gtgaaggagctggaagcgcttgaacatcttcagctggacttctggcgtgctcccgcccac
cccgagatcccagtcgatgtgcgggtcccattctccagcctccaaggggtcaaggtcttc
ctggagtccaacaacatccaatactccatcatgattgagaacgttcagaaattagttgat
gaggaaaagctcttcatgtcatggacgcactttatgccccgatccgtggaaaacttcaac
tacgcttcgtaccacaatatagatgaaatctacgatttcatggatcttctagtgagtgaa
aatcccttggtcagcaaaatccagattggcaagagttacgaaggtcgtccaatcaatgtc
ttgaagttcagcaccggaggaaccaagcgcccagccatctggatcgacaccggcatccac
tctcgcgaatgggtcactcaggccagtgggatctactttgcaaagaagatcctcgacact
tatggcaaagacccttcactgacttctattctggataattttgacatcttccttgaaatt
gtcaccaatcccgatggatttgccttcactcagagcaagaaccgcatgtggcgcaagacg
aggtcaatcaatgctgggtcgtcgtgcgttggagtagaccccaaccggaactgggatgca
ggttttggaggggccggtgccagtggcagcccttgcaccgaaacctaccgcgggccttat
gccaactccgagccagaggtgaaagccattgttgactttgtgaagagccacggcaacatt
aaggccttcatctccatccacagctactcccagctccttctttatccttttggatacacc
cgcacggctgcggcggataaggcggaacttgatgccgttgctaagaaggcagtcgatgct
cttgcttccctccatgggaccaaatacaaatacggtagcatcatcaccaccatctaccaa
gcaagtggaggaaccatcgattggacctacgagcagggtatcaagtactcctacaccttt
gagttgagggacactggccgctacgggttcctgctgcctgccagccagatcatcccgacg
gctgaagagacttggctgggcctcatggtcatcatggaacacacccgggacaacccctat
taa

DBGET integrated database retrieval system