KEGG   Anolis carolinensis (green anole): 100564057Help
Entry
100564057         CDS       T01608                                 

Gene name
nup205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
acs  Anolis carolinensis (green anole)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100564057 (nup205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 2013 aa AA seqDB search
MSAPLAVISAASLWGPYKDIWQAVVNAIWKRQPEAIHLLDQVLKKHKPDFISLFRNPPKN
AQQHQKVQKANTEGIAIQGQQGTRLLPEPLIKEAFILSDLFDIGELAAVELLLAGEHQLP
RFPGLTRGLVAVLLYWDGKRWIANSLRTLIQSRQGKTWTLELSPELVSITTRFTDELMEQ
GLTQKILTLVSQIDLNVEFEKLQKERGLGTEKHRKEVADLIKECRQSLAESLFVWTCQSP
LSRDDTLILISFLEKVTLEADGSLDRVNIALLMALLYCFDISFLEQGSENREELMQQLPL
LTERQYIAAIHTRLQESRPWKLPGLQATIRLAWALALRGISQFSDVTALAEFTEADEAMA
ELAIADNVFLFLTESVVRAENFYQDEFYIRRIHSLVTDFLTLMPMKVKQLRNRADEDARM
IHMSIQMGNEPPLSLRRDLEHLMLLIAELYSEDPFNLELALEYWCPSEPLQSTTIIGSYL
GITHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCSHYCFTLLKGNGGS
HAENIQGAGGSPVSWEHFFHSLMLYHEQLRKDLPSADSIQYRHLPPRGITQKEQDGLIAF
LQLTKTIVKWSENARLALCEHPQWTPVVIILGLLQCSIPPILKAELLETLSAFGKSPEIA
ASLWQSLEYTQILQTVRTPGQRQAIGIEVELNEIESRCEEYPLTRAFCQLIGTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEAVLEVFYKLLRDYEPQL
EDFVDQYVELKGEEIIAYKPPGFNLMYHLLNESPMLELSLSLLEEGVKQLDLYAPFPGKK
HLEKAVQYCLGLLNLTLQKENLFMDLLRESYLSLIVTSLEQLLQGINPRTKKADHVVNIA
RYLYHGNTNPELAFESSKILCCISCNSNIQVKLIGDFTQDQNISQKLMAGFVECLDNETA
EEIINPDEELEGERKQAPIYHETRINILNLLITSLECSPPNLALYLLGYEFKKPVSTTNL
QDPGVLGCPRTCLHAILNILENGTKTRSGPTAVQESPHLAELCYQVIYQLCACSDTSGPT
MRYLRTSQDFLFSQLQHLPFSIKDHEIPVLNQMSWLMKTASIELRVTSLNRQRSHTQRLL
HLLLDDVPVKSYLADGEGGTEDESRSVTGFLHFETASKVRRKILSILDSIDFNQQIPEPL
QLDFFDRSQIEQVISNCESRGTHGPVICNVKHLHKVLIAEVNALQGMAALGQRPLLMEEI
STILQYVVERNKLIQCLYAKRHALESWRQLVEIILTACPQDLIQPEDRQLIIRDLLQDLH
DKILDDDAAQELMPVVAGAVFTLTAHLSQSVRTEQKEPLAVPVPGHSQFALMLDGSFTIP
PDSEGMAVGFASLGDSSLHIILRKILDFVLKTGGGFQRVRTHLYGALLYYLQIAQRPDEP
DTLEAAKKTMWERLTAPEDAFSKLQRENMAIIESYGSALMEVVCRDACDGHEIGRMLALA
LLDRIISVDKQQQWLLYLSNSGYLKVLVESLADDDLKLQSLLTPQPPLLKALYTYESKMA
FLTKVAKIQQGARELLRSGVIVTLAQCHVYDMRPEIDQHGIFGMREPPVFIPTPVERYRQ
ILLPALQLCQVILTSSMAQHANAAGQVLQFLISHSDTIQAILRCQEVSAGSLQELALLTG
IISKAALPGVLGDVGLDINEGMQIELQGHIGRFQRQCLSLLTRFGGSDRLRQFKLQDEHA
EGERVNKRDEAELAMQQICANVMEYCQLLMIQCAPTFEHTVCLFTPNLSEFTNRDGPRQD
TQAPVIPYWHLPGLGIILYLLKQSANDFFSYYDSHRQSVSKLQNVEQLPPDEIKELCQSL
TLTVDKISTGQKYILARRRLVKLINNRAKLLSLCCYIIEICLFILWRHLEHYLLHCTPAD
SQDSLLASRTPLKSRRLQDSLSAQPNFDFRSGLSRVSQLDIDQLQLEATNSFGESLQKKL
LDIETLYSKVRSRYTFIQALVRRIRGLLRISRT
NT seq 6042 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgccgctggcggtaatttcagctgccagtttatggggaccctacaaagacatt
tggcaggcagtagttaatgccatttggaaaaggcagcctgaagcaatacatcttcttgac
caggttttaaagaaacataagcctgattttatatcactcttcagaaatccgccaaagaat
gcccagcagcatcagaaggttcaaaaagcaaatacagaaggaattgctatccagggacaa
cagggaaccaggttgttaccagagccgctcatcaaagaggcctttattctgagtgatctt
tttgatattggagaattggcagctgttgaacttctgttggctggagagcaccagctgcct
cgtttccctgggctaactaggggtttagtagcagtcctcttatactgggatggaaagcga
tggattgcaaattcattgcggacacttatccagtctcggcaaggcaagacatggacattg
gagctcagtcctgaattggtgtccataacaacacgctttactgatgagctgatggaacaa
ggtttaactcagaaaattctgactttagtgtctcaaattgatttaaatgttgaatttgaa
aaactacagaaagaacgagggctaggcactgagaaacatcggaaagaggttgctgatctt
atcaaggagtgtcgacagtcattagccgagagcttatttgtttggacttgccagtcacca
ctgagccgggatgatactttaatccttattagtttcttagagaaagtaactctggaagct
gatggctcattggacagagtcaacatagcacttcttatggctcttctctattgctttgac
atcagctttctagaacaaggctctgaaaatcgtgaagagctgatgcagcagttgccactt
ttaacagagagacagtatatagctgcaatccacacacgtcttcaagaatctcgcccctgg
aaactcccaggacttcaagctactattagattagcctgggcgctggccttgcgtgggatt
tcacaattttctgatgtgacagcactggcagaattcaccgaggccgatgaagccatggca
gagttagcaattgcagataatgttttcctgttccttacggaatctgtggtgagagcagag
aacttctaccaagacgaattttatatacgtagaattcatagcctagtcacggactttctc
acgctcatgccaatgaaagtgaaacagctgagaaatcgtgctgatgaagatgctcgtatg
attcacatgagcatacagatgggtaatgagccacctctttcccttagacgtgatctagag
cacctgatgcttttaattgctgaattgtacagtgaggatccttttaatctggaacttgct
cttgagtattggtgtccttcagagcctctgcaaagcaccaccattataggatcatatctt
gggatcacacaccaaagaccacctcagcgtcaggttgttttatctaaatttgttagacaa
atgggagatctccttccaccgacgatttatatcccttacctgaaaatgctccagggattg
gccaacgggcctcagtgttctcattactgctttactttgctaaagggcaacggcggcagt
catgctgaaaatatccaaggagcaggtggcagtcctgtttcctgggaacatttcttccac
tctttaatgttgtaccatgaacaattacggaaagacttaccaagtgctgatagcattcag
tatcgccaccttcctcccagaggcatcacccagaaggaacaagatggactgattgccttt
ctgcagcttaccaaaactatagtgaaatggagtgaaaatgctcgcttggctctttgtgaa
catcctcagtggacaccagtagttatcattttgggacttctgcaatgtagtatccccccc
attttgaaagcagagttattagagactctttcagcctttgggaaatctccagaaattgca
gcttcgttatggcaatcgttggaatacacacagatactacaaactgtcagaactccaggc
caaagacaagctattggcattgaggttgaattgaatgaaattgaatcccgctgtgaggag
taccctttaactcgtgccttttgccagctcattggcacactggttgagagttcattccct
tccaacctgggtgctggactgcgtcccccaggctttgacccctacctgcagtttctgaga
gattcagtgtttcttcggtttcgaacaagggcctatcggagagctgctgaaaagtgggaa
gtggcagaagcagttttggaagtgttttacaaattgctgagagactatgaacctcagctt
gaagattttgtggaccaatatgtggagctgaaaggagaagaaatcatagcctataaacca
cctgggtttaacctgatgtatcatcttttgaatgagtcaccaatgttggaactgtctctt
agcttgctagaagaaggagttaaacagttggatctctatgctccttttcctggaaagaag
catttagaaaaggcagttcagtattgccttgggttgctcaacttgaccctacagaaagag
aaccttttcatggatttgttaagggaaagctatctctccctgatcgttacatccctagaa
caactgctgcaaggaatcaatcctcggactaaaaaagcagaccatgtggtgaatattgcc
aggtatctttatcatggaaataccaaccctgagttggcatttgaaagttccaaaatcctg
tgctgtatttcttgcaattctaacattcaagtcaaactgattggagatttcacacaagat
cagaatatcagccagaaattaatggctgggtttgtggagtgtttggacaatgaaactgca
gaagaaataattaatcctgatgaagaacttgaaggtgaaaggaaacaggccccaatctac
catgaaacaaggattaacattttgaatcttctcattacctctctggagtgcagtccacca
aatcttgctctttatctcctgggttatgaatttaagaagcctgtcagcacaacaaacttg
caggatccaggtgttttgggttgtcctcgtacttgtcttcatgctattttgaacatcctg
gaaaatggtactaaaacaaggtctggtcccacagcagttcaagaatctcctcatctagca
gagttgtgttatcaggtgatctatcagctgtgtgcctgctcagatacttcaggtccaaca
atgagatacttgcgcaccagccaagatttcttattctctcagttgcagcacttaccattt
tctataaaagaccacgagattccagtcttaaaccagatgtcatggctcatgaagactgca
tctatagaattgcgggttacatcactgaaccgccagcgttctcatacacagagactcttg
cacctccttctggatgatgtgccagtcaaatcttatttagctgatggtgaaggagggaca
gaagatgaaagtcggtcagttactggatttcttcattttgagactgcttccaaagtacgc
aggaagatactaagcatccttgattcaattgacttcaaccaacagattccagaacctttg
cagctggatttttttgaccgttcccaaattgagcaagtcatttccaattgtgagagcaga
ggcacacatgggccagttatctgcaatgtcaagcatcttcacaaagttcttattgctgaa
gttaatgccctgcaaggaatggcagcccttggacagaggccactacttatggaggaaatc
agcacaattctccagtatgtcgtggaacgaaataaacttattcagtgtctgtacgcaaag
cgacatgccctagaatcttggaggcagctggtggaaatcatattaactgcctgcccacag
gatctcatacagcctgaagacaggcagcttattatccgtgatctcttacaagatttgcat
gacaagatcctggatgatgatgcagctcaggaattgatgcctgttgtggcaggagccgtg
ttcaccctgacagctcacttaagtcaatccgtgcgaacagagcaaaaggagcccttggct
gtccctgtccctggacactcccaatttgctttgatgctggatggttctttcacgatacca
cctgattctgaaggcatggcggtgggatttgcctctctaggagactcttctcttcatatc
atattgagaaaaattctggattttgtcctgaaaacaggtggtggcttccaacgagtaaga
acacacctgtatggggcactgctgtattatttacagattgctcagagaccagatgaacca
gacactctggaagcagccaagaagaccatgtgggagcgtttaacagctcctgaagatgct
ttcagtaaattgcaacgagaaaacatggcgattattgaaagctatggctctgcccttatg
gaggtggtttgccgagatgcctgcgatggtcatgagataggacgaatgctagctctagcc
ttacttgatcgcatcatctctgtagataagcagcaacaatggttgctgtatctatcaaac
agtggctatctaaaggtgcttgtagaaagcctagcggatgatgacctcaagctgcaaagt
ttgcttactccccagcctcctctacttaaagcactgtatacctatgagtcaaaaatggct
tttttgacaaaagtggcaaaaatacagcaaggagcacgggagctactgcgatctggagtg
attgtgacacttgcacaatgccatgtatatgacatgcgacctgaaatagatcagcatgga
atatttggaatgcgagagccccccgtcttcattcccacccctgtagaacgctatcgccag
attcttctgcccgctctccagctatgccaggtcatcctcacttccagtatggcacagcat
gcaaacgctgcaggacaggttttgcagtttctaatctcccattcagatactattcaagct
atcttgcggtgtcaggaagtcagtgctggatccctgcaagagctggccttactgacaggg
ataatcagcaaagctgctctgcctggtgtactaggtgacgttggccttgatataaatgaa
ggaatgcaaatcgaactgcaaggacatataggccgatttcagcgccagtgcttgagcctt
ctaacacggtttggtggttcagacagactgcgtcagtttaagttgcaagatgaacatgca
gagggagagcgagtaaacaagagggatgaagctgaactggccatgcagcagatctgtgcc
aatgtgatggaatactgccagttgctcatgatacagtgcgcccccacttttgagcacacc
gtttgcctctttactccaaacctttctgaattcactaacagagatggacctcggcaagat
acacaggcacctgtgatcccctattggcatttgcctggtctgggcatcatcctttatttg
ttaaagcagagtgcaaatgatttcttcagttactatgatagccatcgccagagcgtcagc
aaattgcagaatgtggagcagctaccaccagatgagataaaagagctgtgccagtcactt
actctaacagtagacaagatctctactggccaaaaatatatcttggcaaggcgacgcttg
gtgaagctgattaacaatcgagccaaattgctttctctctgttgctatatcattgaaatt
tgcctgtttattctttggcgacaccttgaacactatttattgcattgcactcctgcagat
tcccaagattctcttttggcttccaggactccactgaaaagtagaagattgcaagattcc
ttaagtgcacagcctaacttcgattttagaagtggattgagcagagtgagccaacttgat
atagatcagcttcagcttgaggccaccaacagttttggggaatcattgcagaaaaaactc
cttgacattgaaactttatactccaaggttcggtcacgctacacttttatccaagcgctg
gttagacggatccgtggtctgttgaggatatcaaggacctga

DBGET integrated database retrieval system