KEGG   Anolis carolinensis (green anole): 100564123Help
Entry
100564123         CDS       T01608                                 

Gene name
ncoa3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 1393 aa AA seqDB search
MSGLGENSLDSMTSDSRKRKPLPCDTPGPGLICSGEKRRREQESKYIEELAELISANLSD
IDNFNVKPDKCAILKETVRQIRQIKEQGKAASADDDVQKADVSSTGQGVIDKDSLGPLLL
QALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSIYSILHEEDRKDFLKNLPKSAV
NGVSWTNEAPRQKSHTFNCRMMVKTIHDLLEDVGSNQDTHQRFETMQCFALSQPRAMLEE
GEDLQSCMICVARRISAMERVFSPNTESFVTRHDLSGKLVNIDTNSLRSMKPGCEDTIRR
CIQRFLCQNEGQPWSNKRHYQEAYIQGHSETPFYRFSLADGTIVIAQTKSKLFRNPVTND
RHGFISTHFLQREQNGYRPNPGSMGQNIRAPTTGGTNSGGGVMNMLPGQNMPLQNRTYGM
GDPNLMGQMSSARYGAHGNMGSMNAAPGMQSSPYQSNYGLNMSSPPHGSPGLNSSQQNLM
ISPRNRGSPKVNSHQYSPVTGVHSPMGPASNTSNNFSSSSLSALQAISEGVGTSLLSTLS
SPGPRLDNSPNMNVSQQSKMGNQDSKSPPGIFPEQNQVESSMCQSNSRDSLGNKDSKDES
LEGSDQRGPAESKGHKKLLQLLTCSSEDRGHSTLSNSPLDSTCKDSSTNATSPSSGVSSS
TSGGVSSSNMQEKHRILHKLLRNGNSPAEVAKITAEATGKDTYHDSSTVSCGEGMVKQEQ
MSPKKKENHALLRYLLDKDDAKDSLSKDIKPKIECLDSKMGQCCNSAIPTSSQEKEMKIK
TEPTEEMSGDLVDNLDAILGDLTNSDFCSNPISTNGSNIGNKQPLCQGTVPLGMRSPQPV
QNTRPPFNRAMSLDSPISVGSSAPVRGINAFSMLQKQSMMGGSPRITENQENFATNMGGS
SRNMPMNQHSASDWSVQNSKVSRIEPTSAGSMTRPGADCNLSLSRSSVGGSMPGLPMRSN
SMPGTRTMLQQQMIHMRPNEINMGMGGNPYVHPGPSNQPNAWPDSMLSVEQGPRGSQNRQ
LVRNSLDDLLYSSPTVDGQSDERALLDQLHTLLSSTDVTSLEEIDRALGIPDLVNQGQPL
EPKQEPFHGQEPAVMIEQKPPMYSQPYQGQGAAIPGGFSSMQGQQAAFNSVMNQMNQQSN
FPMQNMHPRANVMRPRTNTPKQLRMQLQQRLQGQQFLNQTRQTLDIKMENPNPGNASVMR
PVMPPQMGSQGFLNAQMVAQRNRELISHHIRQQRMAMMMQQQQQQSQTFSPPPNVTASGS
MDGAVAGPPMAPVPPQQFSYPSNYGMNQPPDPAFSRVSSPPNPLMAQRMGPSQNPMMQHP
QATPMYSSPEMKGWPSGSMARSSSFPQQQFSHPGNPAAYNMLHMNSNGGHLGPMNINTMP
MSGMPMGPDQKYC
NT seq 4182 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggggagaactccttggacagcatgaccagtgattcaagaaaacgcaag
ccattgccctgtgataccccgggaccaggtttaatttgcagcggggagaaacgtcgacgt
gagcaagaaagcaaatatattgaagaactggctgagctgatatctgctaacctgagtgac
attgataatttcaatgtcaagccggataaatgtgcaattttaaaggaaactgttagacag
atacgacaaataaaggaacaaggaaaagcagcttcagctgatgatgatgttcagaaagct
gatgtgtcttcaactggtcaaggtgttattgacaaagattcattgggacctcttctgtta
caggcattggatggcttcttatttgtagtcaatcgagatgggaacattgtatttgtatct
gaaaatgtcactcagtatttgcaatataagcaggaggacttggttaatacaagtatttac
agtattttgcacgaggaagatcggaaggatttccttaaaaatttaccaaaatctgcagtg
aatggagtttcttggaccaatgaagcacctagacagaagagtcacacatttaattgccgc
atgatggtgaaaacaatacatgatcttctggaagatgtagggagcaaccaagatacacat
caaagatttgaaaccatgcagtgttttgctttatcacagccaagagctatgttagaagaa
ggtgaagatttgcagtcttgtatgatatgtgtggcacgccgtatctctgcaatggaaagg
gtattttcaccaaatacagaaagctttgttactaggcatgatctttcaggtaaacttgtc
aacatagatacaaactctctcaggtccatgaaacctggatgtgaagatacaatccgtcga
tgtattcagagatttttatgtcaaaatgaaggacagccctggtcaaacaaacgccattat
caagaagcatatatacaaggccactctgaaactccattctatcggttttccttagcagat
ggaacaatagtgatagcacagacaaaaagtaaactgtttcgaaacccagttaccaatgac
cgccatggatttatctccactcactttcttcaaagagaacaaaatggatatcgaccaaat
cctggttcaatgggacagaatatcagagcacccaccaccgggggcacaaattcaggtggt
ggtgttatgaatatgttgcctgggcaaaacatgcctttgcagaacaggacctatggcatg
ggagatcctaacttaatgggacaaatgagcagtgctagatatggtgcccatggaaatatg
ggatcaatgaacgctgcgccaggaatgcagtcttctccttatcagagtaactatggatta
aatatgagcagcccaccacatggcagcccaggcttaaattccagtcaacagaatttaatg
atatctcctagaaatcgtgggagtcctaaagtgaattcacaccagtattctcctgtaaca
ggtgtgcactctccaatgggacctgccagcaatactagcaacaacttctcaagcagctca
cttagtgctcttcaggccattagtgagggggttggaacatctcttctgtctacgctttct
tcaccgggtcccagactggacaattctccaaatatgaatgtttctcaacagagtaaaatg
gggaaccaggactcaaagagccctccaggcatatttcctgagcaaaatcaggtggagagc
tctatgtgtcaatcaaacagcagggactcccttggtaacaaggatagcaaagacgagagt
cttgaaggatctgatcaaaggggaccagctgaaagcaaaggtcataaaaaacttcttcag
ttactcacttgttcgtcggaggaccgagggcattcaacactgtcgaactctcccttagac
tctacttgcaaagactcatctaccaatgctacaagcccttcctctggagtttcctcttct
acctctggaggggtttcttcatcaaacatgcaagagaagcatagaattttgcataagttg
ctacggaatggtaattctccagcagaggtagcaaaaatcactgctgaagctactggcaaa
gatacataccatgatagcagtacggtttcctgtggggaaggaatggtgaaacaggagcaa
atgagtcctaaaaagaaagagaaccatgctctgcttagataccttcttgacaaggatgat
gcaaaagattcactttcaaaagacattaaacctaaaatagaatgtttagacagcaaaatg
ggacagtgctgtaactctgccatccctacgtcaagtcaagagaaagagatgaaaataaaa
acagaacccacagaagagatgagtggagatttggtggacaatttagatgcaattttgggt
gatctaactaactcagatttttgcagtaatcctatctctacaaatgggagtaatataggg
aataagcaacctttatgtcaaggaactgtaccactaggtatgagaagtccccagcctgta
cagaacacccgtcctcctttcaacagagccatgtctttagacagccccatatcagtgggt
tcaagtgcaccagtgaggggtatcaatgcattttccatgttacagaagcaaagcatgatg
ggtggtagtccaagaattactgagaaccaggaaaattttgctactaatatggggggatct
agcagaaatatgcccatgaatcagcattcagcaagtgactggagtgtacaaaactcaaaa
gtgagcagaatagagcctacaagtgctggttcaatgacaagaccaggggcagactgcaat
ctttccctttctagatcttcagtcggtgggtccatgcctggtttgcccatgagatccaat
agtatgcctggaactagaaccatgctccaacaacagatgattcatatgagaccaaatgag
attaatatgggtatgggtggaaatccttatgtacatccaggaccatctaaccaaccaaat
gcatggcctgacagcatgctctctgttgagcaaggtccacgaggttcacaaaacaggcaa
ttagttagaaattctttggatgaccttttatactcttctccaactgttgatggccaaagt
gatgaaagagctcttttagatcagctacacacattgctgagtagtacagatgtcactagc
cttgaagaaatcgatagagccttagggattcctgatcttgtaaatcaagggcaaccatta
gaaccaaaacaagaaccctttcacgggcaagaacctgcagtaatgattgagcagaaacct
ccaatgtatagccagccctaccaggggcagggagcagcgataccaggaggttttagtagc
atgcagggccagcaggcagcgtttaattcggtgatgaaccagatgaaccaacagagcaat
ttcccaatgcagaatatgcatcccagagcaaatgtaatgagaccaagaaccaatacacca
aagcaacttcgcatgcaactccaacagaggcttcaagggcagcagttcttgaatcaaaca
cgtcagacacttgatatcaaaatggagaatcccaacccgggaaatgcatcagttatgaga
ccagttatgcctccacagatgggatcacaaggcttccttaatgcacagatggtggcccag
cgaaatagggagctaataagtcaccacatcagacagcaacgaatggccatgatgatgcag
caacagcagcaacaatctcagaccttcagccctcccccaaatgttactgcctcaggaagc
atggatggtgcagtcgcaggccctccaatggctccagtcccaccccagcagttttcatac
ccatcaaattatggaatgaaccagccaccagatcctgccttcagcagggtgtccagtcct
cctaatcccttgatggctcaaagaatgggaccctcgcagaatcccatgatgcagcatccc
caggcgacaccaatgtattcttctcctgagatgaagggctggccatcaggaagtatggcc
agaagcagttcctttccacagcaacagttcagccatcctgggaatcctgcagcttacaac
atgttgcacatgaacagcaatggtggtcaccttgggccaatgaatattaatactatgcct
atgtcaggaatgcccatgggcccagaccagaaatactgctga

DBGET integrated database retrieval system