KEGG   Anolis carolinensis (green anole): 100564123Help
Entry
100564123         CDS       T01608                                 

Gene name
ncoa3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100564123 (ncoa3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 1398 aa AA seqDB search
MIRMSGLGENSLDSMTSDSRKRKPLPCDTPGPGLICSGEKRRREQESKYIEELAELISAN
LSDIDNFNVKPDKCAILKETVRQIRQIKEQGKAASADDDVQKADVSSTGQGVIDKDSLGP
LLLQALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSIYSILHEEDRKDFLKNLPK
SAVNGVSWTNEAPRQKSHTFNCRMMVKTIHDLLEDVGSNQDTHQRFETMQCFALSQPRAM
LEEGEDLQSCMICVARRISAMERVFSPNTESFVTRHDLSGKLVNIDTNSLRSMKPGCEDT
IRRCIQRFLCQNEGQPWSNKRHYQEAYIQGHSETPFYRFSLADGTIVIAQTKSKLFRNPV
TNDRHGFISTHFLQREQNGYRPNPGSMGQNIRAPTTGGTNSGGGVMNMLPGQNMPLQNRT
YGMGDPNLMGQMSSARYGAHGNMGSMNAAPGMQSSPYQSNYGLNMSSPPHGSPGLNSSQQ
NLMISPRNRGSPKVNSHQYSPVTGVHSPMGPASNTSNNFSSSSLSALQAISEGVGTSLLS
TLSSPGPRLDNSPNMNVSQQSKMGNQDSKSPPGIFPEQNQVESSMCQSNSRDSLGNKDSK
DESLEGSDQRGPAESKGHKKLLQLLTCSSEDRGHSTLSNSPLDSTCKDSSTNATSPSSGV
SSSTSGGVSSSNMQEKHRILHKLLRNGNSPAEVAKITAEATGKDTYHDSSTVSCGEGMVK
QEQMSPKKKENHALLRYLLDKDDAKDSLSKDIKPKIECLDSKMGQCCNSAIPTSSQEKEM
KIKTEPTEEMSGDLVDNLDAILGDLTNSDFCSNPISTNGSNIGNKQPLCQGTVPLGMRSP
QPVQNTRPPFNRAMSLDSPISVGSSAPVRGINAFSMLQKQSMMGGSPRITENQENFATNM
GGSSRNMPMNQHSASDWSVQNSKVSRIEPTSAGSMTRPGADCNLSLSRSSVGGSMPGLPM
RSNSMPGTRTMLQQQMIHMRPNEINMGMGGNPYVHPGPSNQPNAWPDSMLSVEQGPRGSQ
NRQLVRNSLDDLLYSSPTVDGQSDERALLDQLHTLLSSTDVTSLEEIDRALGIPDLVNQG
QPLEPKQEPFHGQEPAVMIEQKPPMYSQPYQGQGAAIPGGFSSMQGQQAAFNSVMNQMNQ
QSNFPMQNMHPRANVMRPRTNTPKQLRMQLQQRLQGQQFLNQTRQTLDIKMENPNPGNAS
VMRPVMPPQMGSQQQGFLNAQMVAQRNRELISHHIRQQRMAMMMQQQQQQSQTFSPPPNV
TASGSMDGAVAGPPMAPVPPQQFSYPSNYGMNQPPDPAFSRVSSPPNPLMAQRMGPSQNP
MMQHPQATPMYSSPEMKGWPSGSMARSSSFPQQQFSHPGNPAAYNMLHMNSNGGHLGPMN
INTMPMSGMPMGPDQKYC
NT seq 4197 nt NT seq  +upstreamnt  +downstreamnt
atgatcagaatgagtggattaggggagaactccttggacagcatgaccagtgattcaaga
aaacgcaagccattgccctgtgataccccgggaccaggtttaatttgcagcggggagaaa
cgtcgacgtgagcaagaaagcaaatatattgaagaactggctgagctgatatctgctaac
ctgagtgacattgataatttcaatgtcaagccggataaatgtgcaattttaaaggaaact
gttagacagatacgacaaataaaggaacaaggaaaagcagcttcagctgatgatgatgtt
cagaaagctgatgtgtcttcaactggtcaaggtgttattgacaaagattcattgggacct
cttctgttacaggcattggatggcttcttatttgtagtcaatcgagatgggaacattgta
tttgtatctgaaaatgtcactcagtatttgcaatataagcaggaggacttggttaataca
agtatttacagtattttgcacgaggaagatcggaaggatttccttaaaaatttaccaaaa
tctgcagtgaatggagtttcttggaccaatgaagcacctagacagaagagtcacacattt
aattgccgcatgatggtgaaaacaatacatgatcttctggaagatgtagggagcaaccaa
gatacacatcaaagatttgaaaccatgcagtgttttgctttatcacagccaagagctatg
ttagaagaaggtgaagatttgcagtcttgtatgatatgtgtggcacgccgtatctctgca
atggaaagggtattttcaccaaatacagaaagctttgttactaggcatgatctttcaggt
aaacttgtcaacatagatacaaactctctcaggtccatgaaacctggatgtgaagataca
atccgtcgatgtattcagagatttttatgtcaaaatgaaggacagccctggtcaaacaaa
cgccattatcaagaagcatatatacaaggccactctgaaactccattctatcggttttcc
ttagcagatggaacaatagtgatagcacagacaaaaagtaaactgtttcgaaacccagtt
accaatgaccgccatggatttatctccactcactttcttcaaagagaacaaaatggatat
cgaccaaatcctggttcaatgggacagaatatcagagcacccaccaccgggggcacaaat
tcaggtggtggtgttatgaatatgttgcctgggcaaaacatgcctttgcagaacaggacc
tatggcatgggagatcctaacttaatgggacaaatgagcagtgctagatatggtgcccat
ggaaatatgggatcaatgaacgctgcgccaggaatgcagtcttctccttatcagagtaac
tatggattaaatatgagcagcccaccacatggcagcccaggcttaaattccagtcaacag
aatttaatgatatctcctagaaatcgtgggagtcctaaagtgaattcacaccagtattct
cctgtaacaggtgtgcactctccaatgggacctgccagcaatactagcaacaacttctca
agcagctcacttagtgctcttcaggccattagtgagggggttggaacatctcttctgtct
acgctttcttcaccgggtcccagactggacaattctccaaatatgaatgtttctcaacag
agtaaaatggggaaccaggactcaaagagccctccaggcatatttcctgagcaaaatcag
gtggagagctctatgtgtcaatcaaacagcagggactcccttggtaacaaggatagcaaa
gacgagagtcttgaaggatctgatcaaaggggaccagctgaaagcaaaggtcataaaaaa
cttcttcagttactcacttgttcgtcggaggaccgagggcattcaacactgtcgaactct
cccttagactctacttgcaaagactcatctaccaatgctacaagcccttcctctggagtt
tcctcttctacctctggaggggtttcttcatcaaacatgcaagagaagcatagaattttg
cataagttgctacggaatggtaattctccagcagaggtagcaaaaatcactgctgaagct
actggcaaagatacataccatgatagcagtacggtttcctgtggggaaggaatggtgaaa
caggagcaaatgagtcctaaaaagaaagagaaccatgctctgcttagataccttcttgac
aaggatgatgcaaaagattcactttcaaaagacattaaacctaaaatagaatgtttagac
agcaaaatgggacagtgctgtaactctgccatccctacgtcaagtcaagagaaagagatg
aaaataaaaacagaacccacagaagagatgagtggagatttggtggacaatttagatgca
attttgggtgatctaactaactcagatttttgcagtaatcctatctctacaaatgggagt
aatatagggaataagcaacctttatgtcaaggaactgtaccactaggtatgagaagtccc
cagcctgtacagaacacccgtcctcctttcaacagagccatgtctttagacagccccata
tcagtgggttcaagtgcaccagtgaggggtatcaatgcattttccatgttacagaagcaa
agcatgatgggtggtagtccaagaattactgagaaccaggaaaattttgctactaatatg
gggggatctagcagaaatatgcccatgaatcagcattcagcaagtgactggagtgtacaa
aactcaaaagtgagcagaatagagcctacaagtgctggttcaatgacaagaccaggggca
gactgcaatctttccctttctagatcttcagtcggtgggtccatgcctggtttgcccatg
agatccaatagtatgcctggaactagaaccatgctccaacaacagatgattcatatgaga
ccaaatgagattaatatgggtatgggtggaaatccttatgtacatccaggaccatctaac
caaccaaatgcatggcctgacagcatgctctctgttgagcaaggtccacgaggttcacaa
aacaggcaattagttagaaattctttggatgaccttttatactcttctccaactgttgat
ggccaaagtgatgaaagagctcttttagatcagctacacacattgctgagtagtacagat
gtcactagccttgaagaaatcgatagagccttagggattcctgatcttgtaaatcaaggg
caaccattagaaccaaaacaagaaccctttcacgggcaagaacctgcagtaatgattgag
cagaaacctccaatgtatagccagccctaccaggggcagggagcagcgataccaggaggt
tttagtagcatgcagggccagcaggcagcgtttaattcggtgatgaaccagatgaaccaa
cagagcaatttcccaatgcagaatatgcatcccagagcaaatgtaatgagaccaagaacc
aatacaccaaagcaacttcgcatgcaactccaacagaggcttcaagggcagcagttcttg
aatcaaacacgtcagacacttgatatcaaaatggagaatcccaacccgggaaatgcatca
gttatgagaccagttatgcctccacagatgggatcacaacaacagggcttccttaatgca
cagatggtggcccagcgaaatagggagctaataagtcaccacatcagacagcaacgaatg
gccatgatgatgcagcaacagcagcaacaatctcagaccttcagccctcccccaaatgtt
actgcctcaggaagcatggatggtgcagtcgcaggccctccaatggctccagtcccaccc
cagcagttttcatacccatcaaattatggaatgaaccagccaccagatcctgccttcagc
agggtgtccagtcctcctaatcccttgatggctcaaagaatgggaccctcgcagaatccc
atgatgcagcatccccaggcgacaccaatgtattcttctcctgagatgaagggctggcca
tcaggaagtatggccagaagcagttcctttccacagcaacagttcagccatcctgggaat
cctgcagcttacaacatgttgcacatgaacagcaatggtggtcaccttgggccaatgaat
attaatactatgcctatgtcaggaatgcccatgggcccagaccagaaatactgctga

DBGET integrated database retrieval system