KEGG   Anolis carolinensis (green anole): 100564160Help
Entry
100564160         CDS       T01608                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 12
  KO
K11842  ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100564160
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100564160
Ubiquitin system [BR:acs04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100564160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 Peptidase_C98 NapB CEBP_ZZ
Motif
Other DBs
NCBI-GeneID: 100564160
NCBI-ProteinID: XP_008121970
Ensembl: ENSACAG00000002615
UniProt: H9G6I0
Position
Un
AA seq 372 aa AA seqDB search
MEVLMTVRRLASICTMGANASALEKEIGPEQFPMNEHYFGLVNFGNTCYCNSVLQALYFC
RPFREKVLAYKVQPRKKESLLTCLSDLFNSIATQKKKVGVIPPKKFISRLRKENELFDNY
MQQDAHEFLNYLLNTIADLLQEEKKQEKQNGKLQNGSLESSGGDEGEKGDLTWVHEIFQG
TLTNETRCLNCEAVSSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEQCRS
KQEAQKRMRVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDR
MYDLVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNS
ESGYILFYQSRD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcctgatgacggtgcggagactcgcctccatctgtaccatgggcgccaatgcc
tccgctttggagaaagagattggtccggagcaatttcccatgaatgagcattactttggc
ttggtcaactttggcaacacctgctactgcaactcagtcctccaggcactgtacttctgc
cgcccctttcgggagaaggtcttggcctacaaggttcagccccgcaagaaggagagcctc
ctgacgtgcctctcggacctcttcaacagcatcgccacccagaagaagaaggtgggcgtc
atccctcccaagaagtttatttcccggctgaggaaagagaacgaactctttgacaattac
atgcagcaggacgctcacgagttcctcaactacctgctgaacaccattgccgacttgcta
caagaagagaagaagcaggagaagcagaacgggaagctccagaacgggagtctcgagagc
agtggcggcgacgagggggagaagggcgacctcacctgggtccacgaaatcttccagggg
accctcaccaatgaaaccagatgcctgaactgcgaagccgttagcagcaaagatgaggac
tttctggacctgtcggttgacgtggaacaaaatacgtcgataacgcactgtttgaggggg
ttcagcaataccgagactctgtgcagtgaatacaaatactactgtgagcaatgccgtagt
aaacaggaagcacaaaagaggatgcgggtgaaaaagctgcccatgatcctcgccctgcac
ttgaagcggttcaagtacatggaccagctgcaccggtacaccaagctctcctaccgggtc
gtcttccccttggagctccggctcttcaacacgtcgggcgacgccacaaacccggaccgg
atgtacgacttggtggccgtggtggtgcattgtggcagtggtccgaaccgtgggcattat
atcaccattgtgaagagccatgggttttggctgctgtttgacgacgacattgtagagaaa
atcgacgctcaagcgattgaagagttctatggcttgacgtcggacatttccaaaaactcg
gaatctgggtatatcctcttttaccagtcgagagactaa

DBGET integrated database retrieval system