KEGG   Anolis carolinensis (green anole): 100564230Help
Entry
100564230         CDS       T01608                                 

Definition
cartilage oligomeric matrix protein-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
acs  Anolis carolinensis (green anole)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100564230
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100564230
  Cellular commiunity
   04510 Focal adhesion
    100564230
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100564230
  Exosomal proteins of colorectal cancer cells
   100564230
  Exosomal proteins of bladder cancer cells
   100564230
Heparan sulfate/heparin binding proteins [BR:acs00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100564230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 708 aa AA seqDB search
IKEITFLKNTVMECDACGMGTGATGHPISLAPLSRCYPNPCFPGVTCTDTATGFRCGTCP
QGYTGNGTHCTDINECTANPCFPRVQCINTAPGFRCERCPAGYTGPVHEGVGLAFARANK
QVCNDINECESGTARTCVPNSICINTRGSYKCGSCKAGFVGDQTSGCRSKAERRCPNGEL
SPCHEKAECFVERDGSLVCVCKVGWAGNGYICGPDTDIDGFPDEKLRCTDKKCRKDNCVT
VPNSGQEDADRDGIGDACDDDADGDGITNTEDNCVFVRNTDQRNTDQDNFGDACDNCRNV
KNNDQKDSDGDGRGDLCDDDMDGDKVKNVLDNCVRIPNPDQRDSDGDGVGDVCDSCPHIS
NPDQKDTDHDLVGDPCDTNQDRDGDGHQDSRDNCPSVPNSSQLDSDRDGIGDECDDDDDN
DGIPDQRPPGPDNCRLVPNPGQQDSDRDGIGDACTNDFDKDLVVDQIDVCPENAEVTLTD
FRAFQTVVLDPEGDAQIDPNWIVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNT
ATDDDYAGFIFGYQDSASFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSKTGPGEYL
RNSLWHTGDTPDQVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRARFYEGPELVADTG
VVLDTTMRGGRLGVFCFSQENIIWSNLRYRCNDTIPEDYESYRNQRDY
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atcaaggagatcaccttcttgaaaaacacggtcatggaatgtgacgcctgtgggatgggc
acgggagccacagggcaccccatcagcctggccccgctgagccgctgctaccccaacccg
tgcttcccgggcgtcacgtgtacagacaccgccaccggcttccgctgcggcacgtgcccc
caaggctacaccggcaacgggacccactgcaccgacatcaacgagtgcacagccaatccc
tgcttcccgagagtccagtgtatcaacacggcccctggtttccggtgtgaacgatgcccc
gccggatacacgggaccggtccacgagggggtgggcttagccttcgccagggccaacaaa
caggtttgcaacgacatcaacgagtgcgaatccggcaccgccaggacctgcgtcccaaac
tccatctgcatcaacacccggggatcctacaagtgcggttcctgcaaagccggcttcgtg
ggtgaccagacgagtggctgccggagcaaggccgagcggcggtgccccaatggggagctc
agcccctgccacgaaaaggccgagtgcttcgtggagcgcgacgggtctctggtctgcgtg
tgcaaggtcggttgggcaggaaatggctacatctgcggaccggacaccgacatcgatggc
ttccccgatgaaaagctccgctgcaccgacaaaaagtgccgcaaggacaactgtgtcacc
gtcccgaactctggccaagaggacgcagaccgggatgggatcggcgacgcttgcgacgat
gacgccgacggggacgggatcaccaacaccgaggacaattgtgtctttgtacgcaacacc
gaccagcgtaacaccgaccaggacaattttggcgatgcctgcgacaactgccgcaacgtc
aagaacaacgaccagaaagacagcgacggagacgggcgcggcgacctctgcgacgacgac
atggacggagataaggtgaaaaacgtgttggacaactgcgtgaggattcccaacccggac
cagcgggacagcgacggggacggcgtgggcgacgtctgtgacagctgcccacatatcagc
aatccagaccagaaagacaccgaccacgatctcgtgggcgatccctgcgacaccaaccaa
gaccgggatggagacggccaccaggactctcgggacaactgcccctcggtgcccaacagc
tcccagctcgattcggaccgggatggcatcggggacgaatgcgacgacgacgacgacaac
gacggcatcccggaccagaggccgccgggccccgacaactgccgcctggtccccaaccct
gggcagcaggactccgaccgagacggcatcggagacgcctgcaccaacgacttcgacaag
gacctcgtcgtcgaccagatcgacgtctgtcccgaaaacgcggaggtgacgctgacggat
ttccgggccttccagaccgtcgtcttggatcccgaaggggacgcccagatcgacccgaac
tggatcgtcctcaaccagggaatggaaattgttcagaccatgaacagcgacccaggtttg
gccgtcggctacaccgcgttcaacggggtggacttcgagggcaccttccacgtcaacacg
gccacagacgacgactacgccgggttcatcttcggctaccaagacagcgccagcttctac
gttgtcatgtggaaacaaatggagcaaacctattggcaggccaaccctttccgagccgtc
gccgagccggggatccagctaaaggcggtgaaatccaagaccgggccgggcgaatacctc
cgcaactccctctggcacaccggagacacccccgaccaggtcaggctgctgtggaaagac
ccccggaacgtgggctggaaggacaagacttcctaccgctggttcttgcagcaccggcca
caagtgggctacatccgggctcgtttctacgaaggacccgaactggtggccgacacgggg
gtcgtgctggacaccacgatgcggggcggacgtctgggcgtcttctgcttctcccaggag
aacatcatttggtccaacctgcggtaccgctgcaacgataccattcccgaagactacgag
tcgtaccggaaccagcgggactactaa

DBGET integrated database retrieval system