KEGG   Anolis carolinensis (green anole): 100564230Help
Entry
100564230         CDS       T01608                                 

Gene name
comp
Definition
cartilage oligomeric matrix protein
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
acs  Anolis carolinensis (green anole)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100564230 (comp)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100564230 (comp)
  Cellular commiunity
   04510 Focal adhesion
    100564230 (comp)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100564230 (comp)
  Exosomal proteins of colorectal cancer cells
   100564230 (comp)
  Exosomal proteins of bladder cancer cells
   100564230 (comp)
Heparan sulfate/heparin binding proteins [BR:acs00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100564230 (comp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 763 aa AA seqDB search
MTVFPRLVLLLGLWPWAATGQMPGGRGGDLSPQMLSEMRETNQVLREITELLKQQIKEIT
FLKNTVMECDACGMGTGATGHPISLAPLSRCYPNPCFPGVTCTDTATGFRCGTCPQGYTG
NGTHCTDINECTANPCFPRVQCINTAPGFRCERCPAGYTGPVHEGVGLAFARANKQVCND
INECESGTARTCVPNSICINTRGSYKCGSCKAGFVGDQTSGCRSKAERRCPNGELSPCHE
KAECFVERDGSLVCVCKVGWAGNGYICGPDTDIDGFPDEKLRCTDKKCRKDNCVTVPNSG
QEDADRDGIGDACDDDADGDGITNTEDNCVFVRNTDQRNTDQDNFGDACDNCRNVKNNDQ
KDSDGDGRGDLCDDDMDGDKVKNVLDNCVRIPNPDQRDSDGDGVGDVCDSCPHISNPDQK
DTDHDLVGDPCDTNQDRDGDGHQDSRDNCPSVPNSSQLDSDRDGIGDECDDDDDNDGIPD
QRPPGPDNCRLVPNPGQQDSDRDGIGDACTNDFDKDLVVDQIDVCPENAEVTLTDFRAFQ
TVVLDPEGDAQIDPNWIVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDD
YAGFIFGYQDSASFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSKTGPGEYLRNSLW
HTGDTPDQVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRARFYEGPELVADTGVVLDT
TMRGGRLGVFCFSQENIIWSNLRYRCNDTIPEDYESYRNQRDY
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgactgtttttccgcgactggtgcttctgctcggcctctggccttgggccgccactgga
caaatgcccggaggaagaggaggagacctctcgccccaaatgctctcggagatgagagag
acgaaccaagtgctgcgggaaatcacggagttgctgaaacagcagatcaaggagatcacc
ttcttgaaaaacacggtcatggaatgtgacgcctgtgggatgggcacgggagccacaggg
caccccatcagcctggccccgctgagccgctgctaccccaacccgtgcttcccgggcgtc
acgtgtacagacaccgccaccggcttccgctgcggcacgtgcccccaaggctacaccggc
aacgggacccactgcaccgacatcaacgagtgcacagccaatccctgcttcccgagagtc
cagtgtatcaacacggcccctggtttccggtgtgaacgatgccccgccggatacacggga
ccggtccacgagggggtgggcttagccttcgccagggccaacaaacaggtttgcaacgac
atcaacgagtgcgaatccggcaccgccaggacctgcgtcccaaactccatctgcatcaac
acccggggatcctacaagtgcggttcctgcaaagccggcttcgtgggtgaccagacgagt
ggctgccggagcaaggccgagcggcggtgccccaatggggagctcagcccctgccacgaa
aaggccgagtgcttcgtggagcgcgacgggtctctggtctgcgtgtgcaaggtcggttgg
gcaggaaatggctacatctgcggaccggacaccgacatcgatggcttccccgatgaaaag
ctccgctgcaccgacaaaaagtgccgcaaggacaactgtgtcaccgtcccgaactctggc
caagaggacgcagaccgggatgggatcggcgacgcttgcgacgatgacgccgacggggac
gggatcaccaacaccgaggacaattgtgtctttgtacgcaacaccgaccagcgtaacacc
gaccaggacaattttggcgatgcctgcgacaactgccgcaacgtcaagaacaacgaccag
aaagacagcgacggagacgggcgcggcgacctctgcgacgacgacatggacggagataag
gtgaaaaacgtgttggacaactgcgtgaggattcccaacccggaccagcgggacagcgac
ggggacggcgtgggcgacgtctgtgacagctgcccacatatcagcaatccagaccagaaa
gacaccgaccacgatctcgtgggcgatccctgcgacaccaaccaagaccgggatggagac
ggccaccaggactctcgggacaactgcccctcggtgcccaacagctcccagctcgattcg
gaccgggatggcatcggggacgaatgcgacgacgacgacgacaacgacggcatcccggac
cagaggccgccgggccccgacaactgccgcctggtccccaaccctgggcagcaggactcc
gaccgagacggcatcggagacgcctgcaccaacgacttcgacaaggacctcgtcgtcgac
cagatcgacgtctgtcccgaaaacgcggaggtgacgctgacggatttccgggccttccag
accgtcgtcttggatcccgaaggggacgcccagatcgacccgaactggatcgtcctcaac
cagggaatggaaattgttcagaccatgaacagcgacccaggtttggccgtcggctacacc
gcgttcaacggggtggacttcgagggcaccttccacgtcaacacggccacagacgacgac
tacgccgggttcatcttcggctaccaagacagcgccagcttctacgttgtcatgtggaaa
caaatggagcaaacctattggcaggccaaccctttccgagccgtcgccgagccggggatc
cagctaaaggcggtgaaatccaagaccgggccgggcgaatacctccgcaactccctctgg
cacaccggagacacccccgaccaggtcaggctgctgtggaaagacccccggaacgtgggc
tggaaggacaagacttcctaccgctggttcttgcagcaccggccacaagtgggctacatc
cgggctcgtttctacgaaggacccgaactggtggccgacacgggggtcgtgctggacacc
acgatgcggggcggacgtctgggcgtcttctgcttctcccaggagaacatcatttggtcc
aacctgcggtaccgctgcaacgataccattcccgaagactacgagtcgtaccggaaccag
cgggactactaa

DBGET integrated database retrieval system