KEGG   Anolis carolinensis (green anole): 100564272Help
Entry
100564272         CDS       T01608                                 

Definition
circadian locomoter output cycles protein kaput-like
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 742 aa AA seqDB search
MTRTLHFVNELMDEDEKDRAKRASRNKSEKKRRDQFNVLIKELCTMLQGHGHPLKMDKST
ILQRTIDFLQKQREITAQTEACEIRQDWKPSFLSNEEFTQLMLEYKTKHRPMQIMPFQFC
NSEMLSLFLSAEKQIEFCCHFARGNLDPNETITYEYVKFVVDFKYFTHVPTSSHNGFESA
IARVFRSANEEQICLVATVRLVTPQFLKELCNVEEPCEEFTSRHSLEWKFLFLDHRAPPI
IGYLPFEVLGTSGYDYYHADDLELLARCHEHLMQFGKGKSCYYRFLTKGQQWIWLQTHYY
ITYHQWNSKPEFIVCTHTVVSYAEVRAERRRDLGLEESSVELASSSLKSHGSFLDIRHCA
PSQEASRERLSASSPSSRRSSHTALSDSASSSSIRHTEASTPTRQSLPMGPSEKAPLRLP
SSSSTPPVYHFPAQMGMMHQLKEQLEERTRILQADIKTQQEELHVIKEQLQLVQDSNLQM
LMQQPMPMVFGGVQHQSPRRPSQQQATAAANRPAAAKKSQQQQQQQQQGLMPSKQFCGTH
LASPQQFQVQQQQQQPKHVMRGSQVQQACLPMQMSISMPLYNNPMVFSQAHPITVSAPMA
AEMGERQPLPDYNQDRSLRFAQEQPGLPPAVQMQPITCATIAPSPVFTPSVMIPHSNVAA
QQNHAPNALHQWQPPQVQQHHLYLQMHGAAEQGQAQRLFPQPHLSQPSAAAMGYFHHPQQ
PQSHHMQGQPCGLQDLPEMQLP
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaactctgcattttgtaaacgagctgatggacgaagatgagaaggacagggca
aagagggcatcgcgcaacaagtccgagaagaagaggcgagaccagttcaatgtcctcatt
aaggagctttgcaccatgttgcagggccacggccacccgctcaagatggacaaatccacc
atattgcagaggaccatcgacttcttacagaaacagagagaaatcacagcacagaccgag
gcctgtgagattagacaagactggaagccttcgttccttagcaatgaagagttcacccag
ttgatgttagagtataaaacaaagcaccggccaatgcaaatcatgccgtttcaattctgc
aattctgaaatgttgtccctctttctttcagccgaaaaacaaatagaattttgctgccat
ttcgcccgaggaaacttggacccaaatgaaaccatcacgtacgaatatgtcaagtttgtc
gtcgacttcaaatattttacgcatgtgcctacatcatctcacaacggctttgaatccgcc
atcgcccgggtgtttcgatccgccaacgaagagcagatctgcctcgtcgcaaccgtccgc
ctggtcacgccacagttcctgaaggaactttgcaacgtggaagagccgtgcgaagaattc
acatcgaggcacagcctggaatggaagtttttgtttttggatcacagagccccaccgatt
atcggatatttgccgtttgaggtcctcgggacgtctgggtacgactattatcacgccgac
gacttggagctcctcgctcggtgccacgaacacttgatgcagtttggcaaagggaagtcc
tgctactaccggttcctgaccaaaggccagcagtggatatggctgcaaacgcactactac
atcacctaccaccagtggaactccaaacccgagttcatcgtctgcacccacacggtggtg
agttatgctgaggttcgagcggaaagaagacgagatctcggccttgaggagtcatctgtg
gaactggcatcttcttccttgaagagtcacgggagtttcctcgacatccgccattgcgct
cccagccaggaggccagccgagaaaggctctccgcctcctcgcccagctcccgacgatcc
tcacacacggcactttcggactctgcgtcctcctcctccattcggcacactgaagccagc
accccgacgcggcaatcgttgccaatggggccgtcagaaaaagcacctttgaggctccct
tcaagcagcagcacaccgccggtgtatcacttcccagcccagatggggatgatgcatcag
ctgaaggaacagctggaggagaggacacgcatcttgcaggccgacatcaagacgcagcaa
gaagaactgcacgtgatcaaggagcagctccagctggtgcaagactccaacttgcagatg
ttgatgcagcagcccatgccgatggtcttcggtggcgttcagcaccagagtccaaggcgg
ccttcccagcagcaggcaacggccgcagcaaacagaccggccgctgcaaagaagtcccag
caacagcagcaacagcagcagcaaggcctaatgccatccaagcagttctgcggcacacac
ttggcctcaccgcagcagttccaggtgcagcagcagcagcaacagccaaagcacgtcatg
cgaggcagccaggtccagcaggcctgcttgcccatgcagatgagcatttcgatgccgctc
tacaacaaccccatggtgttctcccaagcgcaccccatcactgtgtctgctccgatggcg
gccgaaatgggcgagcggcaaccgctgcccgactacaaccaagatcggagcttaaggttt
gctcaggagcagccgggccttcctcctgcggtgcagatgcagcccatcacgtgtgccacg
atcgccccgtcgcccgttttcaccccgtcggtgatgatcccgcacagcaacgtcgctgca
cagcagaaccacgctcccaatgctctccaccagtggcagcctccgcaggttcagcagcat
cacctctaccttcagatgcacggggcggctgagcagggccaggcccagcgcctcttcccg
cagccccacctctcgcaaccgagtgccgccgccatgggctacttccaccacccgcagcag
ccccagagccaccacatgcagggccagccctgcggcttgcaagaccttcccgaaatgcag
ctgccttga

DBGET integrated database retrieval system