KEGG   Anolis carolinensis (green anole): 100564278Help
Entry
100564278         CDS       T01608                                 

Definition
acyl-CoA desaturase-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:acs01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:acs01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:acs03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 361 aa AA seqDB search
MRVPWSVPQQCFLQLSPEFTTTTAFGHETQNGSIVKEKTHPIYDDLASGRGMTDDIFDET
YREKEGPKPVTVYVWRNIILMSLLHFFALYALLLIPSTKPLTLLWAFLCFILSGLGITAG
AHRLWSHRSYKATLPLRIFLAVVNSMAFQNDIYEWARDHRAHHKFSETDADPHNASRGFF
FSHIGWLLVRKHPDVIEKGQKLTLADLKADKVVMFQRKFYKPAVVIMCFLIPSLVPWYYW
GESYHNSFLIAAILRYTVILNATWLVNSAAHMYGNRPYDRHINPRQNHFVAFGALGEGFH
NYHHTFPYDYATSEFGTRWNFTTVFIDCMCYLGLASDCKKVSKELILARKIRTGDGSHKT
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagagttccttggtctgtccctcagcagtgcttcctacaactttctccagaattcact
accactactgcctttggtcatgagactcaaaatggatcaattgttaaagagaagacccat
ccaatatatgatgacctggcatctgggagaggcatgactgatgacatttttgatgagacc
taccgtgagaaagaaggccccaagcccgtcacagtatatgtctggaggaacatcatcctt
atgtccctgctccatttttttgcactctatgccctccttctcattccttccacaaagcct
ctcaccttgttgtgggcatttttatgcttcatcttgagtggtcttggaatcacagctgga
gcacatcggctttggagtcaccggtcttacaaagccaccctgcctcttcgaatattctta
gctgttgttaactccatggctttccagaatgatatttatgagtgggccagagaccatcgt
gcccaccacaaattctctgaaacagatgcagatccccacaatgcaagtcggggctttttc
ttttctcatattggctggttgctggtacgaaaacaccctgatgtcatagagaagggacaa
aagctgactctcgctgacctgaaggctgataaagttgtgatgttccagagaaagttttac
aagcccgctgtggtgatcatgtgcttcttgataccttcgcttgtgccttggtactactgg
ggagaatcctatcataatagcttcttaatagctgccatccttcgctacacagtgatactc
aatgctacctggttggtgaacagcgcggcccacatgtatggcaaccggccctacgatcga
catatcaaccccagacaaaaccactttgttgcatttggagccttaggtgaaggctttcac
aactaccaccatactttcccctacgattacgcaaccagtgaatttggcacaaggtggaat
ttcactacagttttcattgattgtatgtgttaccttggcttggcaagtgactgtaagaaa
gtgtccaaggagctcatcttggcccgtaaaattcggactggagatggtagtcataagact
ggttga

DBGET integrated database retrieval system