KEGG   Anolis carolinensis (green anole): 100564278Help
Entry
100564278         CDS       T01608                                 

Definition
acyl-CoA desaturase-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100564278
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100564278
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100564278
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100564278
Lipid biosynthesis proteins [BR:acs01004]
 Desaturase
  First
   100564278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 361 aa AA seqDB search
MRVPWSVPQQCFLQLSPEFTTTTAFGHETQNGSIVKEKTHPIYDDLASGRGMTDDIFDET
YREKEGPKPVTVYVWRNIILMSLLHFFALYALLLIPSTKPLTLLWAFLCFILSGLGITAG
AHRLWSHRSYKATLPLRIFLAVVNSMAFQNDIYEWARDHRAHHKFSETDADPHNASRGFF
FSHIGWLLVRKHPDVIEKGQKLTLADLKADKVVMFQRKFYKPAVVIMCFLIPSLVPWYYW
GESYHNSFLIAAILRYTVILNATWLVNSAAHMYGNRPYDRHINPRQNHFVAFGALGEGFH
NYHHTFPYDYATSEFGTRWNFTTVFIDCMCYLGLASDCKKVSKELILARKIRTGDGSHKT
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagagttccttggtctgtccctcagcagtgcttcctacaactttctccagaattcact
accactactgcctttggtcatgagactcaaaatggatcaattgttaaagagaagacccat
ccaatatatgatgacctggcatctgggagaggcatgactgatgacatttttgatgagacc
taccgtgagaaagaaggccccaagcccgtcacagtatatgtctggaggaacatcatcctt
atgtccctgctccatttttttgcactctatgccctccttctcattccttccacaaagcct
ctcaccttgttgtgggcatttttatgcttcatcttgagtggtcttggaatcacagctgga
gcacatcggctttggagtcaccggtcttacaaagccaccctgcctcttcgaatattctta
gctgttgttaactccatggctttccagaatgatatttatgagtgggccagagaccatcgt
gcccaccacaaattctctgaaacagatgcagatccccacaatgcaagtcggggctttttc
ttttctcatattggctggttgctggtacgaaaacaccctgatgtcatagagaagggacaa
aagctgactctcgctgacctgaaggctgataaagttgtgatgttccagagaaagttttac
aagcccgctgtggtgatcatgtgcttcttgataccttcgcttgtgccttggtactactgg
ggagaatcctatcataatagcttcttaatagctgccatccttcgctacacagtgatactc
aatgctacctggttggtgaacagcgcggcccacatgtatggcaaccggccctacgatcga
catatcaaccccagacaaaaccactttgttgcatttggagccttaggtgaaggctttcac
aactaccaccatactttcccctacgattacgcaaccagtgaatttggcacaaggtggaat
ttcactacagttttcattgattgtatgtgttaccttggcttggcaagtgactgtaagaaa
gtgtccaaggagctcatcttggcccgtaaaattcggactggagatggtagtcataagact
ggttga

DBGET integrated database retrieval system