KEGG   Anolis carolinensis (green anole): 100564328Help
Entry
100564328         CDS       T01608                                 

Definition
cell division cycle protein 27 homolog
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
acs  Anolis carolinensis (green anole)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100564328
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100564328
   04114 Oocyte meiosis
    100564328
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100564328
Protein phosphatases and associated proteins [BR:acs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100564328
Ubiquitin system [BR:acs04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     100564328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 833 aa AA seqDB search
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEDALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQRSLSLNPFLWSPFESLCEIGEKPDPEQTFKLTSIQNFSSCL
PNTCTTMVSNHSIPHRQPETVLMETPQDTLELNRLNLESSNSKYSSNTDSSISYIDSAVI
SPDAVPLGSGTAFLTKQAQNKPKTGRSLLGGPAALSPLTPSFGVLPLETPSPGDGSYLQN
CTNSSSVIDVPPPVAPTKKSVTRITQGGTKSVFSQSGNSREVTPILVAQTQSSGPQTSTT
PQVLSPTIAAPPNVLPRRSSRLFSSDSSTTKENSKKLKMKFPPKIANRKTKCKTNKGGIT
QPNINDSLEITKLDSSIISEGKIASVTPQIQAFTLQKAAAEGLMSLLRDMGKGYLALCSY
NCKEAIHILSHLPSHHYNTGWVLCHIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELEKALACFRNAIRMNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALHINPQSSVLLCHIGVVQHALKKSEKALDTLNKAINIDPKNPLCKFHRASVLFANEKY
KYALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPLTQEEQISEGGPYESVGTDESQASSMTDADDTQLHAVESDEF
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcccttaaccattatgct
tatcgggatgcagtgtttctggcagaaagactatatgcagaagtgcactcagaagatgcc
ctattcttattggcaacctgttactatcgctcaggaaaagcatacaaagcatacaggcta
cttaaaggacacagttgtaccaccccacagtgtaaatatttgcttgccaaatgctgtgtt
gacctcagcaaacttgcagaaggagagcagatcttgtctggtggagtattcaacaaacaa
aaaagccacgacgacattgtgacagagtttggtgactctgcatgcttcacactttcactc
ctggggcatgtttactgcaagacagatcgacttgccaaaggatctgaatgttaccaaagg
agccttagtttaaatcctttcctctggtccccctttgaatcattatgtgaaataggtgag
aaaccagatcctgaacaaacattcaagttaacatctatacagaacttcagcagctgcttg
cctaacacatgcacaaccatggtgtctaatcacagcataccccacagacagccagaaaca
gttcttatggaaacaccacaagacacacttgaattaaacagactcaacctggagtcttcc
aactctaaatattcctccaacacagattcctccatctcttatattgattcagctgtaatt
tcaccagatgctgtacctcttggatcaggaactgccttcttaactaaacaggctcaaaac
aaaccaaaaactggccggagtcttctgggtgggccagctgctctgagtccattaacacca
agctttggagtcctgccattagaaacccctagccctggagacggatcctatttacaaaac
tgcacaaattcttcttccgtaattgatgtcccacctccagtagcccctaccaagaagtct
gtcaccagaataacccaaggcgggacaaagtccgtcttctcacaaagtggcaatagccgg
gaagtaacaccaatccttgttgcacaaacacaaagttctggcccacagacaagtactaca
cctcaggtattgagcccaaccattgctgcgccacctaacgtactgcctcgaagaagttca
cgcctgttctctagtgatagttctacaacaaaggagaatagtaaaaagttaaaaatgaag
tttccgcccaaaattgcaaaccgaaagacaaaatgtaaaaccaataagggagggatcacg
caacccaacattaatgacagtttggaaatcactaaacttgactcgtccatcatttcagaa
ggaaagattgcttctgttacaccacaaatccaggcattcacattacagaaagcagcagca
gaaggtttgatgagccttcttcgtgacatggggaaagggtatttagcgttgtgttcttac
aactgtaaagaagcaattcatatactgagccatttgccttctcaccactacaatacgggc
tgggtactgtgccatattggaagagcttattttgagctttcagaatatatgcaggctgaa
aggatattttccgaagtaagaaggattgaaaactacagagtagaaggcatggaaatctac
tcaacaacactatggcatttgcagaaggatgtggcactttctgttctttcgaaagactta
acagatatggataaaaattcaccagaggcatggtgtgctgcaggaaattgcttcagtttg
caacgagaacacgacattgccatcaaattcttccagagagctattcaagttgatccaaat
tatgcttatgcctacactctacttgggcatgaatttgtgttgacagaggaacttgagaaa
gcattagcctgctttagaaatgcaattagaatgaatccgaggcactataatgcctggtat
ggattgggaatgatttactacaaacaagaaaaattcagccttgcagagatgcattttcag
aaagcactacatatcaaccctcagagctctgtcttgttgtgccacattggagttgttcag
cacgccctgaagaaatctgaaaaggctttggatactctgaacaaagcgattaatattgac
cccaagaaccccctctgcaaattccatagagcctcagtattatttgcaaatgagaagtac
aagtatgctttacaagaacttgaagaactgaagcagattgttcccaaagagtctcttgtt
tacttcttaataggaaaggtttataaaaagttgggacagacccatcttgcactgatgaac
ttttcctgggcaatggacttggatcccaagggagccaacaaccagatcaaagaggccata
gataaacggtacttacctgatgacgaagagcctctaacccaagaggagcaaatcagtgaa
ggtggcccatatgaatcagttggcacagatgagtcccaggccagcagcatgactgatgca
gatgacacgcaactccatgcagtagaaagtgatgaattttaa

DBGET integrated database retrieval system