KEGG   Anolis carolinensis (green anole): 100564333Help
Entry
100564333         CDS       T01608                                 

Gene name
kat6b
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100564333 (kat6b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 2024 aa AA seqDB search
MVKLANPLYTEWILEAIQKVKRQKQRPSEERICHAVCVSHGLDKKSVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFLPVKVCDLSKPSKGSKGTCSELRNVDWNKLLRRGIEGLQE
PNGSSLKNIEKYLRSQHDLAGIFNDPVFQRRLRLGAKRAVNNGRLLKEGPQYRVNYGILE
GRGTSRYSSFPISLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADCG
SSGHPSCLKFCLELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECCD
PPLSRMPKGMWICQVCRPKKKGGKLLHEKASQIRRRYAKPIGRPKNKVKQQMLSVTSDEG
SMNAFTGRGSPGRGQKTKVCTTPSSGHAASVKESSSRLAVTDPTWPGATTTKITNTTSTY
ISASTLNVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKMASQKQTCTSHVL
ATGTTQKLKPSSLPPPNPISGQSPSSQKSSTSISSNSPQSSSSQSSAPSFSSLPSNTQLK
GLFDGLSHIYATQGQSRKKGHPSYAPPKRLHRKAPFSSTSKSNTAFCGKKEIRSRFISHS
STSGWGMPRGLAFKAIAHFKQSTFLKKRMILGRLKYKVTPQMGTPSPGKGNLADGRIKPD
QDDGTEIKISIKQENADLFLVGSKDFVTEEDLEIYKQAQELAMEKIGCKIGGETNGRYPS
VIEFGKYEIQTWYSSPYPQEYARLSKLFLCEFCLKYMKSKNILLRHSKKCGWFHPPASEI
YRRKDLSVFEVDGNASKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVG
YFSKEKLCQQKYNVSCIMIMPQYQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRVS
YLAYWKSVVLEYLYCHHEKQISIKGMSRATGMCPHDIATTLQQHRMIDRREEKFVVIKRE
KLISSHMEKLKTNPRINEVDPESLRWTPLLVPNAAVSEEEREAEKEAERLMEQASCWEKE
EQELFSKRANRQLSAKVQSKNKYLRPTENVSAIAEKGQATDPPKESSGDEEEEEEEEEEE
EIMDGHHQNSSPRLAKLQLLAMKRKRSFVLKKKRGRKRRKINSSVTTETISETTEVLNEP
FDNLEEERPMPQGESTFEIDGESDELKAGIQEVFQSPSEEREENEQEKEEQEKDNHSYQN
DTAYRAKAEDSAAILEDVSKDNPEPVVCKQAWPKGMKHYPSKWRQSKERKFGFKLNLYTP
PETPMEPDYQLMGEESKEPAESNPSQDSAVTEEVKNSETILPCEDEAGDSASEYLELSRT
EKTENDLEEVEENNTVEEVESVNSQSKNQQETTEMEKEEPEPLDHDEEEEEGKSRNEDHD
ADDEDESHVCSAEIETQEAAPEEPLKEVLENQESFLGEHEHSVKSSQEDAIDCTVDLVNE
CNSDQKEFPAVLESASEPSNENTEDQNQVENAELNSAFKNTNTETLEIDSETAQAVKSLT
QETAEHEDAFQDSAETQEACQSLQTYTNTNESPQISTLDDCQQSDHSSPVSSVQSHPSQS
VRSANSPNVPPLENSYTQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDL
GSIESTTENYENPSSYDSTMGNSICTNNSSQNSCSYSNLTSTSMTQSSCAVTQQMSNMNG
SCSMMQNTSINSPPPCNVKSPQGCVIERPPSSNQQLPQCSMAANFSPPMQLSEIAETGNA
NIGLYERMGQGEFAAGHYPQPSATFSLAKLQQLTNTLMDHSLPYSHSAAVTSYANSASLS
APLSSTGLVQLSQSPHPVPVGGQVQTTMTPPPNLTPPPMNLPPPLLQRNMATSNIGLSHA
QRLQTQMPGKGHVSGRTKSAPLPPAAASHQPQIYGRASQTVAMQGPARALTMQRGMNMSV
NLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPIMNGGYHANHGYMNQTAQYPMQMQMGMMG
SQPYAQQPMQTTPHSNMMYTPPAHHGYINTGMSKQSLNSTYMRR
NT seq 6075 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgccaacccactttacacggaatggattcttgaagctatacaaaaagtt
aaaaggcaaaagcagagaccatctgaggagagaatttgtcatgctgtctgcgtgtcccat
gggttagataagaaaagtgtttcagaacagttggagctaagtgtccaagatggttctgtt
ctcaaagttaccaataaaggccttgcctcctacaaggacccagataatcctggacgtttc
ctgcctgtcaaggtgtgtgacctttcaaagccttctaaaggatctaaaggcacttgcagt
gagcttcggaatgtggattggaataagcttttgcggagaggaattgaaggactccaggaa
ccaaatggctcttccctgaaaaacatagaaaaatacctgagaagtcaacatgatcttgca
ggtattttcaatgatcctgtgtttcagcggagattacgcttgggagctaaacgtgctgta
aataatgggagactattgaaagaaggaccccagtatagagtaaactatggaatcctggaa
ggcagaggaacatctagatacagttcgtttccaatttcccttccacctgtcagtcttttg
cctcatgaaaaagaccagccacgagctgatcccattccgatatgtagcttctgtttgggg
acaaaagaatctaaccgcgagaagaaaccagaagaactactctcctgtgcagactgtggc
agtagtggacatccttcttgtctgaaattttgtttggaattgacaacaaatgtgaaggcc
ttaagatggcaatgtattgagtgcaagacctgcagtgcctgtagaattcaaggcaaaaat
gctgataacatgcttttctgtgattcttgtgatagagggtttcatatggagtgctgtgac
ccaccactttcccgaatgccaaaagggatgtggatttgccaggtctgcagaccaaagaaa
aaagggggaaagttactccatgagaaagcatctcagataagacggcgatatgcaaagcct
attggacgaccaaaaaataaagtaaagcaacaaatgttgtctgtaaccagcgatgaagga
tccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtctgt
accacaccttcatctggtcatgctgcatctgtgaaggaatcaagcagcagattggctgtt
acagaccccacctggcctggtgccaccaccaccaaaatcaccaataccacctccacctac
atatctgcatctacacttaacgttaacaagaaaaccaaagggcttattgatggccttact
aagttttttacaccatcacccgatggtcgcagatcacgaggtgaaataatagacttttca
aagcattatcgtccaaggaaaatggcctctcagaaacaaacatgtacttctcatgtgttg
gctacaggtaccacacaaaagctaaaaccttcttcactcccacccccaaaccccatctct
ggtcagagccccagttcacaaaaatccagcacttcaatctcttccaattctccccaaagc
tcctccagtcaatcaagtgcaccctcctttagcagccttcccagtaacactcagctaaag
ggactctttgatggactttctcatatttatgccactcagggacagtcacgaaaaaaggga
cacccaagttatgcaccgcccaagcgtctgcatcgtaaagcaccgttctcttccacatcc
aagtctaatacagctttctgtggaaagaaagagattagaagtaggtttatttctcattcc
tccacctctggatggggtatgcctagaggacttgcttttaaagcaattgctcacttcaag
caatcaactttccttaaaaaacgcatgattctaggcagattaaagtataaagtgacccct
cagatggggaccccctcaccagggaaggggaacttggcagacggaaggattaaacctgat
caggatgatggtacagaaatcaaaataagcatcaaacaagaaaatgcagatctgtttctg
gtgggaagcaaggactttgtcacagaagaggatttggaaatttataagcaggcccaggaa
cttgccatggagaaaatcggttgtaaaattggtggagaaacaaatggacggtacccttca
gtcatagaatttgggaagtatgaaatccagacttggtactcctcgccttatccgcaagaa
tatgcaagactatcaaagcttttcctgtgtgaattttgtcttaaatatatgaagagtaaa
aatattttgctaagacattcaaagaagtgtggctggtttcatcctccagctagtgaaatc
tacaggaggaaggacctttcagtctttgaggttgatgggaatgcaagcaaaatttattgc
caaaatctttgcttattagcaaagctcttcctagaccataaaacattatattatgatgtt
gagccatttcttttctatgttctcaccaagaatgacgagaaagggtgtcatttagttgga
tacttctcaaaggagaagctctgccaacagaagtacaatgtctcctgcataatgattatg
ccccaataccaaaggcaaggatttggaaggtttctcattgatttcagctacttactttct
agaagagagggacaagcaggatcacctgaaaagccactctctgatctgggtcgcgtttcc
tacctggcctattggaaaagtgttgtactggaatatctttattgccatcacgagaaacag
atcagcatcaaaggaatgagccgagcaactgggatgtgtccccatgacattgctaccacc
ctacagcagcacaggatgatagacaggagagaagaaaaatttgtggtaattaaaagggag
aaactgatttcaagtcacatggagaaactcaaaaccaatccacgcatcaatgaagtagat
ccagaaagcttgaggtggaccccccttttagttcctaatgcagcagtttctgaggaagaa
agagaagctgaaaaagaggctgagcgactgatggaacaagcaagttgctgggaaaaagaa
gagcaagagctgttctccaaacgagctaacaggcaattgtcggcaaaagtgcaatctaaa
aacaagtatttgcgacctacagagaatgtatcagcaatagcagagaaagggcaagccaca
gatccaccaaaagaaagcagtggagatgaggaggaggaggaggaggaggaagaagaggaa
gagattatggatggacatcatcaaaattcttcgccaaggctggcaaaattgcagttactt
gctatgaaaagaaagagatctttcgtactgaaaaagaaaagaggtcgtaaacgcagaaag
attaatagcagtgttacaacagagacaatttctgaaaccaccgaagttctgaatgagccc
tttgataatttagaagaagagcgacctatgccacagggggaatccacttttgagatagat
ggggaaagtgacgaattaaaggctggcattcaagaggttttccagtctccctctgaggag
agagaagaaaatgaacaagaaaaagaggaacaagaaaaagacaatcactcttaccagaat
gatactgcatacagagcgaaagcagaagacagtgcagccatcctggaagatgttagtaaa
gacaatcctgagccagtggtgtgtaaacaagcatggcccaaaggaatgaagcactaccca
tcgaaatggagacaaagtaaagagagaaaatttggttttaagcttaatttgtacactcca
cctgaaactcctatggaacctgactatcagctaatgggagaggaatcaaaagaaccggct
gaaagcaacccatcccaagattctgcagttacagaggaagttaaaaactctgaaaccatt
ttgccatgtgaagatgaggcaggagactcagcatctgagtatttggagttaagcagaaca
gaaaaaactgagaatgatttagaagaagtggaggaaaataatacagtagaagaagtggaa
agtgtgaatagtcagagtaaaaaccagcaagagacaactgaaatggagaaagaggagcct
gagccattagatcatgatgaagaggaggaagagggaaaatctcgtaatgaggatcatgat
gctgatgatgaggacgagagccacgtttgttcagcagaaatagagactcaggaggcagca
ccagaagaaccactcaaagaagtactggagaatcaggagtcttttttaggtgaacatgaa
cacagtgtcaaatcaagtcaggaagatgcaatagactgcactgttgatcttgtaaatgag
tgcaacagtgaccagaaagagtttcctgctgttctggaatctgcatctgagccgagtaat
gaaaatacagaagatcaaaatcaagttgaaaatgcagaactaaattctgcattcaagaac
actaatacagaaaccctggagatagattctgaaacagcccaagcagtaaagtctctaacc
caagaaacagcggaacatgaagatgcatttcaggattctgcagagactcaggaggcatgt
caaagcctacagacttataccaacactaatgaaagtccacagataagcaccttggacgac
tgtcagcagtctgatcacagtagtcctgtctcatctgtccagtcccatcccagccagtca
gttcggtctgctaatagtccaaatgtgcctccattagaaaacagctatactcaaatcagc
cccgatcaaagtgccatctctgttccatctctgcagaatatggaaaccagccccatgatg
gatgttccatctgtttctgaccattctcaacaggttgttgatagtgggtttagtgatctg
ggtagcattgagagtacaactgagaactatgagaatccaagcagctatgattccaccatg
ggcaatagcatctgtacaaacaactcctcacaaaacagctgctcatatagcaatcttaca
tccactagtatgacacagagcagttgtgctgtgactcagcagatgtcgaacatgaatgga
agctgcagcatgatgcagaataccagcattaactccccccctccttgtaatgtgaaatcc
cctcaaggttgtgtaattgaaaggcccccaagcagcaaccagcagcttcctcagtgcagc
atggctgctaactttagcccaccgatgcagttaagtgaaattgcagaaactggcaatgcc
aacattggcttgtatgaaagaatgggccaaggtgaatttgcagcggggcattatccacag
ccatctgctaccttcagccttgccaaactgcaacagttaaccaacacacttatggaccat
tcgttgccttacagtcattcagctgctgttacttcctatgcaaatagtgcctctttgtct
gctcctctcagtagcacaggacttgttcagctgtctcagtctcctcatccggtcccagta
gggggtcaagtccaaactacaatgactccaccccctaaccttactcctcctcccatgaat
ttgccacctccccttctgcagcgtaacatggccacatccaatattggtctctcccatgcc
caaagactgcaaactcagatgcctgggaaaggccatgtttcgggtagaactaaatcagca
cccttaccgccagctgcagcctcccaccagccacagatctatgggcgcgcctcacagact
gtggccatgcaagggccagcacgcgccttaaccatgcagcgtggcatgaacatgagtgtg
aacttgatgcctgcgccagcttacaatgtcaattctgtgaacatgaatatgaatacccta
aatgctatgaatggatatagcatgtcccaacctataatgaatggaggctaccatgcaaat
cacggatacatgaatcaaacggcccagtaccctatgcagatgcaaatggggatgatggga
agtcagccatatgcacaacagccaatgcagactaccccccatagcaacatgatgtatact
cctccagcacatcatggctatataaatactggcatgtccaaacaatctctgaatagtact
tatatgcgcaggtag

DBGET integrated database retrieval system