KEGG   Anolis carolinensis (green anole): 100564408Help
Entry
100564408         CDS       T01608                                 

Gene name
bdnf
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:acs04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 318 aa AA seqDB search
MPPKRNNVTLSEGTTRGRLVCARHVEEPPRSASSAVGAWENRSYRLFKDETPRKKIPVSD
WLTCMFHQVKRVMTILFLTMVISYFSCMKAAPMKEVSLRGQGSLAYPGLRTQGNLENLGG
PNDATRGLTSLADTFEHVIEELLDEQQPVQPSKENKDADLYSSRVMLSSQVPLEPPLLFL
LEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSTSEWVTAAEKKTAVDMSGATVTVLEK
VPVPKGQLKQYFYETKCNSKGYTKEGCRGIDKRYWNSQCRTTQSYVRALTMDNKKRVGWR
FIRIDTSCVCTLTIKRGR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaagaggaataatgtgactctctcggaggggaccacgagaggcaggcttgtg
tgtgctcgtcacgtagaggagccgccccgaagcgcgagcagcgccgtaggagcctgggag
aacaggagttaccgcctcttcaaggacgaaactccgcggaaaaagatacctgttagcgac
tggctaacgtgcatgttccaccaagtgaaaagagtgatgaccatccttttccttactatg
gttatttcatacttcagttgcatgaaagctgccccaatgaaagaagttagcctcagagga
caaggcagcttggcttatcctggtcttcggacacagggaaacttggagaacctaggtggg
cctaatgacgccacacggggattgacatctttggcagacacttttgaacatgtcatagag
gagctcctggatgagcagcagcctgtccagcccagcaaggaaaacaaggatgcagatttg
tactcgtctcgggttatgctcagcagtcaagtgcctttggagcctccactgctctttctg
cttgaggagtataaaaattacttggatgctgcaaacatgtccatgagggtccggcgtcac
tctgaccctgctcgccgtggagagctgagtgtgtgtgacagtacaagtgaatgggtgaca
gcagctgagaaaaagactgcggtggacatgtcaggggcaacggttactgttctggaaaaa
gtacctgtacccaaaggccaactgaagcaatatttttatgagaccaaatgcaactcaaag
ggttacacgaaagagggctgcaggggcatagacaagaggtactggaattcccagtgccga
actacccagtcttacgtgcgagctctcaccatggataacaaaaagagagttggatggcgg
tttataagaatagacacttcctgtgtgtgtacactgaccataaaaaggggaagatag

DBGET integrated database retrieval system