KEGG   Anolis carolinensis (green anole): 100564617Help
Entry
100564617         CDS       T01608                                 

Gene name
elp3
Definition
elongator acetyltransferase complex subunit 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100564617 (elp3)
Transfer RNA biogenesis [BR:acs03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100564617 (elp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 547 aa AA seqDB search
MKQKKKGDLSRAELMMMTIADVIKQLIEAHEQGKDVNLNKIKTKTASKYGLSAQPRLVDI
IAAVPPQYRRVLVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALAEE
YRDYFIRNLHDALSGHTSNSVAEAVRYSERSLTKCIGITIETRPDYCLKRHLSDMLSYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDAGFKVVAHMMPDLPNMGLERDIDQ
FVEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYKSYPPSTLVDLVARILALVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTECRDVRTREVGIQEIHHKVRPYQV
ELIRRDYVANSGWETFLSYEDPEQDILIGLLRLRKCSEETFRAELKAGVSIVRELHVYGS
VVPVSSRDPSKFQHQGFGMLLMEEAERIAKEEHGSWKIAVISGVGTRDYYRKIGYELEGP
YMVKRLD
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagaagaagaagggggacctcagtcgggccgagctgatgatgatgaccattgct
gatgtcatcaagcagttaattgaggcgcacgaacaaggcaaagatgtcaacttaaacaag
atcaaaaccaagacggcttccaaatatgggctttctgcccagcctcgcttggtggacatc
attgccgctgtgcctccgcagtaccgccgtgtgttggttcccaagctgaaggccaagccc
atccggacggcaagcgggatagctgttgtggctgtcatgtgtaagccacataggtgtcca
cacatcaactttacaggaaacatatgtgtatactgtccgggtggtcctgattctgacttt
gaatattcaacccaatcgtatactggatacgagccaacgtcaatgagggccattcgagcc
agatatgacccctacctccagaccaggcaccgtgtcgaacagctgaagcagctgggccac
agtgtggacaaagtggagttcattgtgatgggcgggacattcatggcccttgcggaagag
tacagggattactttattcgtaatttgcacgatgcgctctccggtcacacttcgaacagc
gtggcagaggcagtccgctactccgagcgaagccttacaaaatgcattgggattacaata
gagaccaggccggattattgcttgaagcgccacctgagtgacatgctgtcgtacggatgc
acacggctggagattggggtgcagagcgtctacgaggatgtggccagagatactaacagg
ggccacacggtgaaggccgtgtgcgaatccttccacttagccaaagacgccgggttcaaa
gtggtggcccacatgatgccggatctgcccaacatgggactggaaagggacatcgaccag
tttgtggaatttttcgagaaccctgccttccgcccggacggcatgaagctctacccgact
ctcgtcatccgcggcacggggctttacgaactctggaaaacggggcggtacaagagctat
ccgccaagcacgctggtggatctggtggcaaggatcctggccctcgtgccgccgtggaca
cgcgtgtaccgggtgcaaagggatatccccatgccactggtcagttccggagtggagcac
gggaatttgagagaactagctttggccaggatgaaagacctgggaacggagtgccgcgat
gtgaggacaagagaagtcgggatacaagaaattcatcacaaagtgagaccttatcaggtg
gaactcatccggagagattacgtggccaacagcggctgggagaccttcttgtcttatgag
gaccccgagcaagacatcctgattggcctcctgcgcctgcgcaagtgttcggaggagacc
ttccgagcggagctgaaggcgggcgtctccatcgtccgggagctccatgtctacggcagc
gtggtccccgtcagcagccgggacccttccaaattccagcatcagggatttgggatgctg
ctgatggaggaggcggaaagaatcgccaaggaagagcacgggtcgtggaagattgccgtt
atttcaggtgtgggcaccagggattactaccggaagatcggctatgagctggaagggccc
tacatggtgaagcgattggactga

DBGET integrated database retrieval system