KEGG   Anolis carolinensis (green anole): 100564728Help
Entry
100564728         CDS       T01608                                 

Definition
histone acetyltransferase MYST2-like
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 611 aa AA seqDB search
MSRRKRNAGSSSDGTEDSDFSTDPEHTDSSESDGTLRQSARVTRSSARLSQSSQDSSPVR
NPPSFGGEEPVYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRDTKNAAD
HDESPPRTPTGNAPSSESDIDISSPNMSHDESIAKDMSMKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQVEDRMLSHRQ
DDNNRHATRHQAPTERQLRYKEKVAEMRKKRNAGLTKEQKEKYMEHRQTYGNTREPLLEN
LTSEYDLELFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEXA
RLGRLYMCEFCLKYERTVQCLKXRTAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKSMDP
SCLKWTPPKGT
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccgaaagagaaatgcaggaagcagttctgatgggaccgaggactccgatttc
tctacggacccagagcatacagacagttcagaaagtgatggcactttacgccagtcagcg
cgtgtgacccgctcttctgcgagactcagccagagttctcaagattccagtccagttcga
aatcccccgtcatttggaggagaggagcctgtttattctacccggagagtgacccgcagc
cagcaacagcccacacctgtgactcccaaaaaatatccacttcggcaaactcgctcatct
ggatcagaaacagagcaagtggtggacttttcagatagagacactaaaaatgcagccgac
catgatgagtctccaccccgcacgccaactgggaatgccccatcctcagaatctgacatc
gatatctccagccctaacatgtctcatgatgagagcattgccaaggatatgtctatgaag
gattctggaagtgatttgtcccatcgtcccaagcgccgtcgcttccatgaaagctacaat
ttcaacatgaaatgtcccacccctggctgcaattctttaggacatctgactggaaaacat
gaaagacatttttccatatctggatgtccgctatatcataacctttcagcagatgaatgc
aaggtaagagcccagagccgggacaaacaagttgaggacaggatgctgtctcatcgacaa
gatgacaataatagacatgccaccagacatcaggcaccaaccgaaagacaattaaggtac
aaagaaaaagtagcagagatgagaaagaagaggaatgcagggctgacaaaggagcagaag
gaaaaatacatggagcacagacaaacctatggaaacacaagagagccccttttagaaaac
ctgaccagcgaatatgacctagaactgttccggagagctcaagcaagagcatcagaggat
ctggagaaactgagacttcagggccagatcacagaaggcagcaacatgatcaagacgatt
gcttttggccgctatgagctggacacatggtaccattctccctatccagaggaataggca
cggctggggcgcctctacatgtgtgagttttgcctaaaatatgaaagaacagtacagtgt
ttgaaatgaagaacagcaaagtgtgtctggaagcaccctccaggtgatgaaatttatcgt
aaaggctctatttcggtatttgaagtcgatgggaaaaagaacaagatctattgccagaac
ctgtgccttttggcaaagctattcttagaccacaagactctatactatgatgttgagcct
tttctcttctatgtcatgacagaagctgacaacactggctgccatctgataggctatttc
tccaaggaaaagaactcattccttaactacaacgtttcttgtatcctgacgatgcctcaa
tacatgagacagggttatggcaaaatgcttattgacttcagctacctactttcaaaagtg
gaagagaaggttggctccccagagcgaccgctctcagatctgggtcttattagctaccgt
agttactggaaggaggttcttctccgttatctgcataactttcaaggcaaagaaatctcc
atcaaagaaatcagtcaggagacagctgtcaatcctgttgacattgttagcactctgcag
gcacttcagatgctcaagtattggaagggaaaacatctggttttgaagagacaggatctt
attgatgaatggatagccaaagaggccaaacgatccaacagcaataaaagcatggatccc
agctgtttgaaatggacccctcccaagggcacttaa

DBGET integrated database retrieval system