KEGG   Anolis carolinensis (green anole): 100564761Help
Entry
100564761         CDS       T01608                                 

Definition
galactocerebrosidase-like
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:acs00600]
Cellular Processes; Transport and catabolism; Lysosome [PATH:acs04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 772 aa AA seqDB search
MLPSSPKEAGLVANVTKGGEKKPKHPPSLFLFVFPGQVTQASRDPAWRRNGAPVADASPS
VGHEGAGGAACCCCCFFLVAFTQELRSPPSSRSFFLRRESPSGKMWLCGLALLLGLSVEW
GVEASWGKRSGTYWLDDAAGPTREFDGVGAVSGGGATSRLLVNYPEPYRSQILDYLFKPN
FGAALQILKVEIGGDAQSTDGTEPSHMHYENDENYFRGYEWWLMKEAKKRNPDIKLIGLP
WAFPGWIGKGENWPYKYPDVTAYYIVSWIAGAKKFHSLDIDYVGIWNERSFDSKYIKLLR
YTLDKQELQHVKIIASDNLWEPISFLVLLDSELREAVNIIGAHYPGTTTVLTALQTHKKL
WSSEDYSTFNNELGAGCWARILNQNFVNGNMTATIAWNLVASYYEELPFGRSGLMTAQEP
WSGHYTVSPPIWITAHTTQFTLPGWQYLQVDGHLEGGGSFVALTDGQGNLTIIIETLTHG
HSKCIRPPLFPFIVTPQKATFHLKGSFSKLQALQMWYSKMEFSSSNSTLFQSLGPIKVCE
GVLTLSLGLDEIYTLTTLTTGHKGSFEDPPPSQPFPSKYQDDFNIRNPPFSEAPNFADQT
GVFEYFVNTSDPGEHTYTLRQVVTQRPVTWVADAENTISVLGNYKWVNLTITSDIYIESE
KGGAFIAGRVDKAGIYIGGAKGVFFWVLPDGTYRVTDDLNGNNILMKGLSGVRAKAWHTL
TLILTGSNASGMLNGYPLWENVTVNSPENGWAAIGTRSFEFTQFDNFQVKAS
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgctgccttccagcccaaaggaggcggggcttgtcgccaacgtcacgaagggcggagaa
aaaaaacccaaacatcccccttccctgtttttgtttgttttccctggtcaggtgacccaa
gcgtcacgtgaccctgcttggagacgaaatggagctcctgtcgccgacgcttctccctca
gtcggtcatgaaggcgcgggaggagccgcttgttgctgctgctgcttcttcctcgtcgcc
ttcacgcaggaactgaggtctccgccttcctctcgttcgttcttcctgaggagagaatcc
ccctcagggaagatgtggttgtgtggcttggcgctgctgctgggcctaagcgtggagtgg
ggcgtcgaggcctcttggggcaaacggagcggcacttactggttggacgacgcggcgggg
cccacgagggagttcgacggcgtcggcgcggtcagcggtggaggggcaacttcccgactt
cttgtgaattatccagagccttaccgctctcagattttagattatctttttaagccaaac
tttggtgctgctttgcaaatcctcaaagtcgaaatcggaggggatgcacagtctacagat
ggaactgaaccatcacatatgcactatgagaatgatgagaattatttccggggctatgaa
tggtggctaatgaaagaggcaaaaaagaggaaccctgatattaaattaattggtttgccc
tgggcttttccaggatggattggaaaaggtgagaattggccctacaagtatccagatgtc
actgcttattatattgtctcctggatagccggtgccaaaaaatttcacagtttggacatc
gactatgtcgggatttggaatgagcgttcttttgacagcaagtatattaagcttttgaga
tacactttggataaacaagagcttcaacacgtgaagatcatagccagcgataacctctgg
gagccaatttcctttcttgtgctgctcgactccgagctgcgtgaagcagtcaatattatt
ggggctcattatccaggaacaacaactgtgcttacggccttgcagactcacaagaaactt
tggtcttcagaagattacagcaccttcaacaatgaactgggtgcaggttgctgggctcga
atcctgaatcaaaactttgtgaatgggaacatgacagctactattgcttggaatttagtg
gccagttactatgaggagttgccttttggccggagtggtctaatgacagcacaagaacct
tggagtggacattacactgtgagtcctcccatatggatcacagcacacacaacccagttc
acactaccgggttggcagtacctgcaagtggatgggcatctggaaggaggtggcagcttt
gttgctctgactgatgggcaaggcaatcttactatcatcattgaaacactgacccacggc
cactcaaagtgcatcagaccacctctgtttccattcattgtgacgccccagaaagcaact
ttccacctcaaaggatcctttagcaaattacaggcccttcagatgtggtattctaagatg
gaattttcatcttcaaattctaccttgttccagtctcttggtcctataaaggtctgtgaa
ggggtattaacactcagcctgggtctggatgagatctatactttgacaacactgacaaca
ggccataaaggctctttcgaagatcctcccccatctcagccttttccatcaaaataccaa
gatgatttcaatattcgtaatccaccttttagtgaggcaccaaactttgctgaccaaact
ggggtgtttgagtactttgtaaacacttccgatccaggtgaacacacctatactctccga
caagtggtgactcagagaccggtaacttgggtcgccgatgcagagaatactatcagcgtt
ttaggcaattacaaatgggtaaatctaacaataacaagtgacatttacatagaatcagaa
aaaggaggtgcatttatagcaggaagagtggacaaagctggaatttatattggaggtgcc
aaaggagttttcttctgggtccttccagatggcacatatcgagttacagatgacctcaat
ggtaacaatatcctgatgaaaggactgtctggcgtgcgggctaaagcatggcatacactc
actctgattcttacgggttccaatgcctctggcatgttaaatggctatccactctgggag
aacgttactgtgaactctccagaaaatggctgggcagcgattgggacacgctcttttgaa
tttactcagtttgacaactttcaagttaaggccagttga

DBGET integrated database retrieval system