KEGG   Anolis carolinensis (green anole): 100564761Help
Entry
100564761         CDS       T01608                                 

Gene name
galc
Definition
galactosylceramidase
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100564761 (galc)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100564761 (galc)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     100564761 (galc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 668 aa AA seqDB search
MWLCGLALLLGLSVEWGVEASWGKRSGTYWLDDAAGPTREFDGVGAVSGGGATSRLLVNY
PEPYRSQILDYLFKPNFGAALQILKVEIGGDAQSTDGTEPSHMHYENDENYFRGYEWWLM
KEAKKRNPDIKLIGLPWAFPGWIGKGENWPYKYPDVTAYYIVSWIAGAKKFHSLDIDYVG
IWNERSFDSKYIKLLRYTLDKQELQHVKIIASDNLWEPISFLVLLDSELREAVNIIGAHY
PGTTTVLTALQTHKKLWSSEDYSTFNNELGAGCWARILNQNFVNGNMTATIAWNLVASYY
EELPFGRSGLMTAQEPWSGHYTVSPPIWITAHTTQFTLPGWQYLQVDGHLEGGGSFVALT
DGQGNLTIIIETLTHGHSKCIRPPLFPFIVTPQKATFHLKGSFSKLQALQMWYSKMEFSS
SNSTLFQSLGPIKVCEGVLTLSLGLDEIYTLTTLTTGHKGSFEDPPPSQPFPSKYQDDFN
IRNPPFSEAPNFADQTGVFEYFVNTSDPGEHTYTLRQVVTQRPVTWVADAENTISVLGNY
KWVNLTITSDIYIESEKGGAFIAGRVDKAGIYIGGAKGVFFWVLPDGTYRVTDDLNGNNI
LMKGLSGVRAKAWHTLTLILTGSNASGMLNGYPLWENVTVNSPENGWAAIGTRSFEFTQF
DNFQVKAS
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtggttgtgtggcttggcgctgctgctgggcctaagcgtggagtggggcgtcgaggcc
tcttggggcaaacggagcggcacttactggttggacgacgcggcggggcccacgagggag
ttcgacggcgtcggcgcggtcagcggtggaggggcaacttcccgacttcttgtgaattat
ccagagccttaccgctctcagattttagattatctttttaagccaaactttggtgctgct
ttgcaaatcctcaaagtcgaaatcggaggggatgcacagtctacagatggaactgaacca
tcacatatgcactatgagaatgatgagaattatttccggggctatgaatggtggctaatg
aaagaggcaaaaaagaggaaccctgatattaaattaattggtttgccctgggcttttcca
ggatggattggaaaaggtgagaattggccctacaagtatccagatgtcactgcttattat
attgtctcctggatagccggtgccaaaaaatttcacagtttggacatcgactatgtcggg
atttggaatgagcgttcttttgacagcaagtatattaagcttttgagatacactttggat
aaacaagagcttcaacacgtgaagatcatagccagcgataacctctgggagccaatttcc
tttcttgtgctgctcgactccgagctgcgtgaagcagtcaatattattggggctcattat
ccaggaacaacaactgtgcttacggccttgcagactcacaagaaactttggtcttcagaa
gattacagcaccttcaacaatgaactgggtgcaggttgctgggctcgaatcctgaatcaa
aactttgtgaatgggaacatgacagctactattgcttggaatttagtggccagttactat
gaggagttgccttttggccggagtggtctaatgacagcacaagaaccttggagtggacat
tacactgtgagtcctcccatatggatcacagcacacacaacccagttcacactaccgggt
tggcagtacctgcaagtggatgggcatctggaaggaggtggcagctttgttgctctgact
gatgggcaaggcaatcttactatcatcattgaaacactgacccacggccactcaaagtgc
atcagaccacctctgtttccattcattgtgacgccccagaaagcaactttccacctcaaa
ggatcctttagcaaattacaggcccttcagatgtggtattctaagatggaattttcatct
tcaaattctaccttgttccagtctcttggtcctataaaggtctgtgaaggggtattaaca
ctcagcctgggtctggatgagatctatactttgacaacactgacaacaggccataaaggc
tctttcgaagatcctcccccatctcagccttttccatcaaaataccaagatgatttcaat
attcgtaatccaccttttagtgaggcaccaaactttgctgaccaaactggggtgtttgag
tactttgtaaacacttccgatccaggtgaacacacctatactctccgacaagtggtgact
cagagaccggtaacttgggtcgccgatgcagagaatactatcagcgttttaggcaattac
aaatgggtaaatctaacaataacaagtgacatttacatagaatcagaaaaaggaggtgca
tttatagcaggaagagtggacaaagctggaatttatattggaggtgccaaaggagttttc
ttctgggtccttccagatggcacatatcgagttacagatgacctcaatggtaacaatatc
ctgatgaaaggactgtctggcgtgcgggctaaagcatggcatacactcactctgattctt
acgggttccaatgcctctggcatgttaaatggctatccactctgggagaacgttactgtg
aactctccagaaaatggctgggcagcgattgggacacgctcttttgaatttactcagttt
gacaactttcaagttaaggccagttga

DBGET integrated database retrieval system