KEGG   Anolis carolinensis (green anole): 100564773Help
Entry
100564773         CDS       T01608                                 

Definition
voltage-dependent calcium channel subunit alpha-2/delta-2-like
Orthology
K04859  
voltage-dependent calcium channel alpha-2/delta-2
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100564773
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100564773
   04261 Adrenergic signaling in cardiomyocytes
    100564773
Ion channels [BR:acs04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   100564773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1078 aa AA seqDB search
MAAKMQYWARRLEQEIDGVMRIFGGVQALKRIYDEKRNLFEVRENVPDKIVEKVAGDIES
LLAKKVRALKRLADAAERFQKAHRWQDNIKEENIEYYDSKADTEYDDLDGEEIERDTSNS
LKLEFTDDENFKTKVNYSYAAVQIPTDIYKGSTVILNELNWTEALEDVFVENRKEDPSLL
WQVFGSATGVTRFYPATPWRAPNKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLT
LKLMKTSVYDMLDTLSDDDYVNVASFNQKAQAVSCFTHLVQANIRNKKVFKEKVEVMEAR
GTTDYKAGFEFAFEQLQNSNISRANCNKMIMMFTDGGEDRVQDVFEKYNWPNKTVRVFTF
SVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKKAKQVQWT
NAYQDALGLGLVVTGTLAVFNLTDDGSGEKKNQLLLGVVGIDVALNDIKKLTPRYNLGAN
GYIYAIDLNGYVLLHPNLRPQIINFQEPVTLDFLDAELEDDNKEDIRRRMIDGERGTRNI
WTLVKSQDERYLDKVHRMYTWAPIKSTNYSLGLVLPRYSTYYIRANLSDQILQVKLPSKL
KDFEYLLPNSFESEGHVFIAPREYCKDLNLSDNNTEFLENFIALMEKVTPDSKQCDNFLL
HNLILDTGITQQLVERVWRDQDLNTYSLLAVFVATDGGITRVFPNKAAEDWEEDREPFNA
SFYRRSLDNKGYIFKPPYRDASYRGLELENNTIGILVSTAVELNFGERHLKPAVVGVKLD
LEAWAEKFKVLASNRTERDQLGTRRCDPSTGCEMDCEANYKDLLCVLIDDGGFLVLSNQE
DYWMQVGKFFSEVDAHLMSALFNHSFFTKKESYDFQSVCATEAPSNTGGAPRGVYVPTMA
DFLNLAWWTSAAAWSLFQQFLYGLTYNSWFQTEDVTAEGMESKETSCIMKQTQYYFSTPN
NTDINFIDCGNCSRLFYAQRLTSTNLLFVVAEKPICSQCESTKASSTPPGDRNQCELVER
PRYQKGPHVCFDYNATEDTSDCGRGASFRPSLSVLLSLQLLLLYLTASCHPLPSASCL
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaaaatgcagtactgggccagaaggctggagcaagagatcgatggcgtgatg
aggatatttggtggtgttcaggcactcaaacggatctatgatgagaagaggaacctgttt
gaagtaagagaaaatgttccagataaaatagtggaaaaggtggcaggggacatcgagagc
ctgttggccaagaaagtccgggcattaaagagattggctgatgcagcagagaggtttcag
aaagcccatcgctggcaagacaacatcaaggaagaaaatattgaatactatgactccaag
gctgatacagaatatgatgatctagatggagaagaaattgaaagagatacttctaactct
ttgaagctggaattcacagatgatgaaaattttaaaaccaaggttaactactcttatgct
gctgtgcagatacctacagacatctacaaaggctccactgtcatcctcaatgagctaaac
tggactgaagccttggaagatgtatttgttgaaaaccggaaagaagacccatcattgcta
tggcaggtcttcggaagtgccacaggtgtgacccgcttctacccagccaccccttggaga
gcacccaataagattgacctgtatgacgtccgacgaaggccttggtatatccaaggagcc
tcatctccaaaggacatggttatcatcgtggacgtgagtggcagtgttagtggcctgaca
ctgaagctgatgaagacgtcggtctatgacatgctggacacactgtcagatgatgactac
gtgaatgtggcctcgtttaaccaaaaggcacaggccgtatcctgcttcactcatttagtc
caggcaaatatccgcaacaagaaggtcttcaaagagaaagtggaagtaatggaggctcgg
ggaaccaccgactacaaggcaggctttgagtttgcctttgaacagctgcaaaattccaac
atcagcagagccaattgtaacaagatgatcatgatgttcaccgatggaggagaggatcgg
gttcaggacgtgtttgagaagtataactggcccaacaagactgtacgagtgttcactttt
tctgtcgggcagcataactatgatgtcactcccctgcagtggatggcttgtgctaacaaa
ggttattactttgaaattccctccattggagcaatccgaatcaatacacaggaatacctg
gatgttctaggaagacccatggtcttagcaggaaagaaggcaaaacaggttcagtggacc
aatgcctatcaggatgctttgggtctgggcttggtggtgacgggcactttagcagtgttc
aatctcactgatgatgggagtggtgaaaagaagaatcagctcctcttgggtgttgtggga
atcgatgtggctcttaatgacatcaagaagctgacaccacgatacaatttaggggctaac
ggttatatatatgctattgatctgaatggatatgtattgctacatccaaatctacgacct
cagatcatcaatttccaagaacctgtcactctggatttccttgatgctgaactagaagat
gataacaaagaggatattcgaagaagaatgattgatggagagagagggacacgaaacatc
tggactttggtcaagtctcaagatgagagatatctagataaagtccacaggatgtatacc
tgggcacctatcaagagtacaaactatagcctaggtttagtcttgccacgttacagcacc
tattacatccgggctaacctgagtgaccagattctccaggtgaagttaccaagcaaattg
aaggattttgaatacctgctgccaaacagctttgagtccgagggacatgtgttcattgct
ccaagagaatattgcaaagacctcaacctgtcggataacaacactgaattcctggaaaac
tttatcgccctcatggaaaaggtgacacctgactccaagcaatgtgataattttctcctt
cacaaccttatcctggacacaggcattacccaacagttggttgaaagagtatggagggac
caagacttaaacacatatagcctcctagctgtgtttgttgcaactgatggtggcattacc
cgtgttttccctaacaaagctgctgaagattgggaagaagaccgggaacccttcaatgcc
agcttctatcggcgaagcctagataacaaaggctatatttttaagccaccttatcgggat
gccagctacagagggctggagctggaaaacaatacaattggaatccttgttagcacagct
gttgagctcaactttggtgagaggcacctgaaaccagcagtggttggagtgaaacttgac
ctggaagcctgggcagaaaaatttaaagtccttgcaagtaaccgaacagaaagggatcag
ctgggaacacgaagatgtgacccctccactggctgtgagatggactgtgaggctaattac
aaggatctcctttgtgtgctcattgatgacgggggatttttggtgctctccaatcaggag
gattactggatgcaggtaggcaagttcttcagcgaagtggatgcgcacttgatgtctgct
ctcttcaaccattcatttttcacaaaaaaagaatcatacgacttccaatctgtctgtgcc
acagaagctccaagcaacacaggaggagcaccacgtggagtttatgtgccaacaatggca
gattttctgaatctagcctggtggacctcagcagctgcatggtctctatttcaacagttc
ttgtatgggctaacctacaacagctggtttcaaacagaagatgtcactgcagaaggaatg
gagtccaaggagaccagctgcatcatgaagcagacccagtactactttagtacacctaac
aatactgatatcaactttattgactgtggaaattgctctaggctattctatgcacaaaga
ctgaccagcaccaatcttctgtttgttgtcgcagaaaagccaatatgcagccaatgtgaa
tccaccaaagcttcttcaactccgccgggagatcgcaatcaatgtgagctagtagaaagg
ccacgatatcaaaaaggtccccacgtctgttttgactacaatgcaacagaagacacctca
gactgtggcagaggagcctccttcaggccgtccttgagtgtcttgttatctctgcagctg
ctcctcctctacttgactgccagttgccatccactgccctcggcatcttgcctttga

DBGET integrated database retrieval system