KEGG   Anolis carolinensis (green anole): 100564811Help
Entry
100564811         CDS       T01608                                 

Gene name
eif3b
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
acs  Anolis carolinensis (green anole)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100564811 (eif3b)
Messenger RNA biogenesis [BR:acs03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100564811 (eif3b)
Translation factors [BR:acs03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100564811 (eif3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 890 aa AA seqDB search
MARQGGDTPVGVRMRTHARFPFPPFWSGGRLGVTPVRCVRRAGKAATPVFPMQETEESLA
PAVPDGAEAEKPGEEAEEGSEGAGKPDGPRPTASEEPEGRKAEAEALPEEEEDGEKGERA
PEQEKPASPPPPTAEEKPKPPSPEVKEEEEEGEEEAEEGLVEASEEKYPGEEAKEEQKEE
EEEPKEEQSITTVEEKQPPGPEEEEKAGEEPPPSEKEPEEEEDEEDISFSDPEDFVDDID
EEELLGDILQERPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGNITNEFYPE
ADGQTKGYIFLEYMSPTHAIDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWEIPEK
QPFKDLGNLRYWLEDPDCRDQYSVIFESGDRTTIYWNDVKDPVTIEERTRWTETYVRWSP
KGTYLATFHQRGIALWGGEKFKQIQKFGHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAI
IIWDTLTGQKKRGFHCESSAHWPIFKWSHDGKFFARMTSDTLSIYETPSMGLLDKKSLKI
QGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPSRQEMRVRNLFNVVDCKLHWQKNGD
YLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKESIIAFAWEPNGSKFAVLHGES
PRISCSFYHVKNNGKIELIKIFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCT
MMNIAEHYTASDVEWDPTGRYVITSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLW
RPRPPTLLTQDQIKQIKKDLKRYSKIFEQKDRLSQSKASKELVDRRRTMMEEFKKYRKMA
QELYMEQRNERLELRGGVDTDELDSNVDDWEEETVEFFINEEIISVVEPE
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggcccggcaaggaggagacacccctgtgggtgtacgcatgcgcacgcatgcgcggttc
ccttttccccccttctggagcggcgggcggctgggagtgactcccgttcggtgcgtgagg
cgagcggggaaggccgcgacgccggtttttcccatgcaggagaccgaggagagcctggcg
cctgccgttcccgacggggcggaagcagagaagcccggcgaggaagcggaggagggctcc
gaaggggctgggaagccggacgggcctaggcctactgcctcggaggagcctgaggggagg
aaggccgaggctgaggccttgccggaggaagaggaggacggcgagaagggagaacgggct
ccagagcaggagaagccggcctcgcccccgcctcccaccgctgaggagaagcccaagccc
cccagccctgaagtgaaggaagaggaggaggagggggaagaggaggccgaggaaggcctg
gtggaagcttctgaggagaaatatccaggagaggaagccaaagaggagcagaaggaggag
gaagaagagccaaaggaggagcagtccatcaccacagtcgaggagaagcagcctcccggg
ccggaggaggaggagaaggcgggcgaggagcctcctccctcagagaaggaaccagaggag
gaagaagacgaggaggacatctctttcagtgaccccgaggactttgtggatgacatcgac
gaggaagaattacttggtgatattctacaagaacgcccacaggaggcagatggaattgat
tcagtgattgtagtggacaatgttcctcaggttggaccagaccgtcttgagaaactgaag
aatgttatccataagattttttcaaagtttggtaacattacgaatgaattctaccctgaa
gctgatggacagaccaaagggtatattttcttggaatacatgtctccaactcatgccata
gatgctgttaaaaatgcagatggctacaagctggacaagcagcatactttcagagtgaac
cttttcactgactttgacaaatatatgacaatcagtgatgagtgggaaattccagaaaag
cagccatttaaagatctggggaatttgcgctactggttggaggatccagattgtagagat
cagtacagtgtgatctttgaatctggagataggacaactatatactggaatgatgtcaaa
gatcctgtcacaattgaggagcgaactcgatggacagaaacgtatgtacgctggtctcca
aagggcacctatctggctacattccatcagagaggcattgcactgtggggtggagagaaa
ttcaaacagattcagaaatttggccatcagggagttcagctcattgacttctctccttgt
gaaaggtatctagtaaccttcagtcctctgatggacactcaagatgaccctcaagcgatc
attatctgggataccttaactggacagaagaagcgaggattccactgtgaaagctcagca
cattggcccatttttaagtggagtcatgatggaaaattctttgctcgaatgacatctgat
acacttagcatctatgaaacaccttctatgggtctgttggacaagaagagtttgaaaatc
caagggatcaaagacttctcctggtctcccggtggcaacataattgccttttgggttcct
gaagacaaagatatccccgcaagggtgaccctgatgcaactgccttcccgacaagagatg
agagtccgaaacctgttcaatgtggtggactgcaagctgcattggcaaaagaatggggat
tatctctgtgtgaaggttgacaggacccctaaggggacacagggtgtagtgaccaacttt
gaaatcttccgcatgagggagaagcaagtcccagttgatgtggtggaaatgaaagaaagc
atcatagcctttgcttgggaaccaaatggaagcaagtttgctgtgctgcatggagaatcg
ccacggatatcctgttccttttaccatgtgaagaacaatgggaagatagaactcattaaa
atttttgacaagcagcaagccaacacgatattctggagtcctcaaggacagtttgtggtg
ctggctggtctcaggagcatgaatggtgccttagcatttgtagatacgtctgactgcacc
atgatgaacattgctgagcattacactgcctctgatgtcgaatgggatcccacaggccgt
tatgtcataacctctgtgtcttggtggagtcacaaggtggacaatgcctattggctgtgg
actttccaaggacgtctcctccagaagaacaacaaagaccgattctgccagttactgtgg
agacccaggccgcctactttgctcacccaagatcagataaagcaaatcaagaaagacctg
aagcgctactccaaaatatttgaacagaaagatcgtctcagccaatctaaagcctcaaag
gaattggtagataggagacgaacgatgatggaagagttcaagaaataccgcaagatggcg
caagagctgtacatggaacagaggaatgagcggctggaactcagaggaggagtggacact
gatgagctggacagcaatgtagacgactgggaggaggagaccgttgaattttttatcaat
gaagaaataatttcagttgtagagccagagtaa

DBGET integrated database retrieval system