KEGG   Anolis carolinensis (green anole): 100565034Help
Entry
100565034         CDS       T01608                                 

Definition
m-phase inducer phosphatase 1-B-like
Orthology
K05867  
M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100565034
   04114 Oocyte meiosis
    100565034
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100565034
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100565034
Protein phosphatases and associated proteins [BR:acs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100565034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 519 aa AA seqDB search
MSESSPPTEADVLRSDLGFRSGCRMVLNAFRESEISPPLTPLLPLTPVLSVTWDFENLST
LGGDTPRRCLDLSNLSNGEEEIVFNFNQSSKTLENDQKDPGELQDQLKGSRRQGVQLFQP
QVRCSTPDLPHEIHCVTGEANSPSIIKENEGRLYNHPGWPRSLLFRKRLPDSPLTCYNAM
LEAGDLEIKNLGSPIATVERARAPGSLDSFPEIDLTNQEESERLLTGHLSSMAALLSGPL
LTQDINIRNVSQVSVNKSRLFRSPSLPEKLNRPVLKRAVKVQDDQMAAKVKWKNSTIQEE
ADGTMFLKKTASLSDLEIVKALDQDYSFRQLIGDFSNVYSLPTVSGRHQDLRYITSETMA
ALINDQFQSLIEKFFIIDCRYPYEYRGGHIKGALNIHRQDDLFDFFLKKPLLPPAPQKRI
ILVFHCEYSSERGPKMCRYLREEDRGMNEYPALHYPELYLLQGGYKDFFLAHKELCEPQS
YCPMHHQDFKAEMLKFRVKSKTWAEVRKRKNYITRLMKL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagagcagtcctcccaccgaagcggatgtgcttcgttcagaccttgggtttcga
tctggctgcaggatggtgctcaatgctttccgggaatcagagatctctccacctcttact
ccactactacctcttactccagtcttgagtgtaacctgggattttgagaacctcagcaca
ctaggaggggacactccaagacgctgcctagatctctccaatctcagtaatggggaggaa
gaaattgtcttcaacttcaaccagtcctcaaaaacattggaaaatgatcagaaggaccct
ggggaacttcaggatcaactcaaaggctcgagaaggcaaggtgtgcagctgttccaaccc
caggtacgatgcagcaccccagacctcccacatgaaattcactgtgtaactggggaggcc
aacagtccttccataatcaaagaaaatgaaggcagactgtataatcatccaggatggcca
aggtccctgctgttccggaaaagactaccagactcaccactgacctgttacaatgcaatg
ctggaagctggggacctagagatcaaaaaccttggcagtccaattgctacagtggaacga
gcaagagctccaggcagcctggacagctttccagagattgatctcactaatcaagaagag
tcagagaggcttctcactgggcatctctccagcatggctgccttgttgtctggacctctc
ctcacccaggacatcaatatcagaaatgtgtctcaggtctccgtgaacaagagccgcctc
ttccgatcaccatcactgccagagaaactgaacagacctgtgttgaagagggcagtaaaa
gtccaagatgatcaaatggctgccaaggtaaaatggaagaacagtacaatccaagaagag
gctgatgggaccatgtttttgaagaagacagcctccctgtcagaccttgaaattgtcaaa
gcacttgatcaagactacagcttcagacagctgattggtgatttctccaatgtatattca
ctgccaactgtatcaggaaggcatcaggacctgagatacatcacttctgagactatggct
gctctgatcaatgatcagttccaaagcctcatagagaagttcttcatcattgactgtcgt
tacccctatgagtatcgtggggggcacatcaagggggctttgaatatccacaggcaagat
gatctatttgatttctttctgaagaagcctcttctccccccagcaccacagaagcgcatc
atccttgtcttccactgtgaatattcttctgagaggggacccaagatgtgccgctatttg
agggaggaagaccgaggcatgaatgaatatcctgcactacactaccctgaactttatctc
cttcaaggtggttacaaggatttcttcctagcacacaaggaactgtgtgagccccagagc
tactgtcccatgcatcaccaagacttcaaagcagagatgctgaagtttcgtgtcaaaagc
aagacatgggcagaagtaaggaagcggaagaattatattactcgtctcatgaagctgtga

DBGET integrated database retrieval system