KEGG   Anolis carolinensis (green anole): 100565034Help
Entry
100565034         CDS       T01608                                 

Gene name
cdc25c
Definition
(RefSeq) cell division cycle 25C
  KO
K05867  M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04110  Cell cycle
acs04114  Oocyte meiosis
acs04914  Progesterone-mediated oocyte maturation
Module
acs_M00691  DNA damage-induced cell cycle checkpoints
acs_M00693  Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100565034 (cdc25c)
   04114 Oocyte meiosis
    100565034 (cdc25c)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100565034 (cdc25c)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100565034 (cdc25c)
Protein phosphatases and associated proteins [BR:acs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100565034 (cdc25c)
 Protein Tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    100565034 (cdc25c)
DNA repair and recombination proteins [BR:acs03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    100565034 (cdc25c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: M-inducer_phosp Rhodanese DUF772
Motif
Other DBs
NCBI-GeneID: 100565034
NCBI-ProteinID: XP_008103204
Ensembl: ENSACAG00000006957
UniProt: G1KG01
Position
2
AA seq 516 aa AA seqDB search
MSESSPPTEADVLRSDLGFRSGCRMVLNAFRESEISPPLTPLLPLTPVLSVTWDFENLST
LGGDTPRRCLDLSNLSNGEEEIVFNFNQSSKTLENDQKDPGELQDQLKGSRRQGVQLFQP
QVRCSTPDLPHEIHCVTGEANSPSIIKENEGRLYNHPGWPRSLLFRKRLPDSPLTCYNAM
LEAGDLEIKNLGSPIATVERARAPGSLDSFPEIDLTNQEESERLLTGHLSSMAALLSGPL
LTQDINISEVSVNKSRLFRSPSLPEKLNRPVLKRAVKVQDDQMAAKVKWKNSTIQEEADG
TMFLKKTASLSDLEIVKALDQDYSFRQLIGDFSNVYSLPTVSGRHQDLRYITSETMAALI
NDQFQSLIEKFFIIDCRYPYEYRGGHIKGALNIHRQDDLFDFFLKKPLLPPAPQKRIILV
FHCEYSSERGPKMCRYLREEDRGMNEYPALHYPELYLLQGGYKDFFLAHKELCEPQSYCP
MHHQDFKAEMLKFRVKSKTWAEVRKRKNYITRLMKL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagagcagtcctcccaccgaagcggatgtgcttcgttcagaccttgggtttcga
tctggctgcaggatggtgctcaatgctttccgggaatcagagatctctccacctcttact
ccactactacctcttactccagtcttgagtgtaacctgggattttgagaacctcagcaca
ctaggaggggacactccaagacgctgcctagatctctccaatctcagtaatggggaggaa
gaaattgtcttcaacttcaaccagtcctcaaaaacattggaaaatgatcagaaggaccct
ggggaacttcaggatcaactcaaaggctcgagaaggcaaggtgtgcagctgttccaaccc
caggtacgatgcagcaccccagacctcccacatgaaattcactgtgtaactggggaggcc
aacagtccttccataatcaaagaaaatgaaggcagactgtataatcatccaggatggcca
aggtccctgctgttccggaaaagactaccagactcaccactgacctgttacaatgcaatg
ctggaagctggggacctagagatcaaaaaccttggcagtccaattgctacagtggaacga
gcaagagctccaggcagcctggacagctttccagagattgatctcactaatcaagaagag
tcagagaggcttctcactgggcatctctccagcatggctgccttgttgtctggacctctc
ctcacccaggacatcaatatcagtgaggtctccgtgaacaagagccgcctcttccgatca
ccatcactgccagagaaactgaacagacctgtgttgaagagggcagtaaaagtccaagat
gatcaaatggctgccaaggtaaaatggaagaacagtacaatccaagaagaggctgatggg
accatgtttttgaagaagacagcctccctgtcagaccttgaaattgtcaaagcacttgat
caagactacagcttcagacagctgattggtgatttctccaatgtatattcactgccaact
gtatcaggaaggcatcaggacctgagatacatcacttctgagactatggctgctctgatc
aatgatcagttccaaagcctcatagagaagttcttcatcattgactgtcgttacccctat
gagtatcgtggggggcacatcaagggggctttgaatatccacaggcaagatgatctattt
gatttctttctgaagaagcctcttctccccccagcaccacagaagcgcatcatccttgtc
ttccactgtgaatattcttctgagaggggacccaagatgtgccgctatttgagggaggaa
gaccgaggcatgaatgaatatcctgcactacactaccctgaactttatctccttcaaggt
ggttacaaggatttcttcctagcacacaaggaactgtgtgagccccagagctactgtccc
atgcatcaccaagacttcaaagcagagatgctgaagtttcgtgtcaaaagcaagacatgg
gcagaagtaaggaagcggaagaattatattactcgtctcatgaagctgtga

DBGET integrated database retrieval system