KEGG   Anolis carolinensis (green anole): 100565059Help
Entry
100565059         CDS       T01608                                 

Definition
cytochrome P450 2C29-like
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:acs00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:acs00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:acs00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:acs00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 495 aa AA seqDB search
MEPLGMSTVLLLTCLSCLLLSAIWKSGARQKGKMPPGPTPLPIIGNALQLKTHHLDQVLQ
KMSEKYGPVFTLYFGMAPAVVLHGYEAIKEALLDRGNEFAFRGKIHLMEKTNKGKGIIFS
NGERWKQLRRFALTTLRNFGMGKKSIEERIHEEAQYLLEQFRNTKQQPFDPHYLFSCATS
NVICSIVFGKRYDYKDKKFQAMMNLMNENFEIFNSAWAQFANMFPTLMEWIPGPHHQIVS
GSLRSEEFVLEEAKEHRATLDPNSPRDFIDCFFIKMDQEKHNEASEFTMENLITCSLDLF
GAGTETTSTTLRYGLLILQKYPEIEEKVQEEIDRVVGRSRMPGMADRGQMPYTDAVLHEI
QRFVSLVPLGVPHTVDKDTPFRGYVIPKGTTIVPVLSSVLHDSKEFPNPTEFDPGHFLNK
DGTFRKSDYFVPFSAGKRICAGEGLARMELFLFLTSILQNFKLKPLTDPKDIDIMPRLSS
LSNVPQPYKFCLVPC
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggagcccctggggatgtccaccgtcctcctcctcacctgcctctcctgcctcctgctc
tctgccatctggaaaagtggggcccggcagaagggcaagatgccccccggccccaccccg
ctgcccatcattgggaacgccctgcagctcaagacccaccacctggatcaggttctccag
aagatgagtgagaagtatggtcctgtgtttaccctttattttgggatggctcccgccgtg
gtactccatggctatgaggccatcaaagaagccttgctggaccggggcaatgaatttgca
ttcagggggaaaatacatttgatggagaaaaccaacaaaggcaaagggatcatattcagc
aacggggagagatggaagcagctccggcgctttgccttgaccaccctccgcaactttggg
atggggaagaagagcatcgaggagaggatccatgaggaagcccagtatctcctggagcaa
ttccgcaacacaaaacagcagccctttgacccacattacctgttcagctgtgccacctcc
aatgttatctgctccattgtctttggaaagcgctacgattacaaggacaagaaatttcaa
gccatgatgaacttaatgaatgagaactttgagatttttaactctgcttgggcacagttc
gccaacatgttccctaccctaatggagtggatccctgggcctcatcaccaaatagtgtcc
gggagcctccgatccgaggagtttgttttggaggaagccaaggagcacagggcgactctg
gaccccaactccccgcgggacttcatcgattgcttcttcatcaaaatggatcaggagaag
cacaacgaggcctccgagttcaccatggagaacctgatcacctgcagcctggacttgttt
ggtgcaggaactgaaacgaccagcactacgctccgatacgggcttttgatcctccaaaaa
tacccagagattgaagagaaagtgcaggaggagattgaccgggtggttggccgctcccgg
atgcccggcatggctgaccgcggacagatgccttatacggacgccgtcctccacgagatc
cagaggttcgtctctctcgtcccactcggcgtcccgcataccgtggacaaagacacaccg
ttcagaggatatgtcatcccgaaaggcaccacaatagttcctgttctgagctcagtgctg
catgatagcaaggaatttcccaaccccacagagtttgacccagggcacttcttgaataag
gatgggaccttcaggaagagtgactactttgtgcccttttcagcaggcaaacggatctgc
gcaggggaaggcctggcccgcatggagctcttcctgttcctcacttccattctccagaac
ttcaagctgaagcccctcacggaccccaaggacatcgacatcatgcctcggctgagtagc
ttgagcaatgtccctcagccctacaagttctgccttgtcccttgctga

DBGET integrated database retrieval system